Os02g0121300 - Revision history

Xysj1981 at 04:58, 8 March 2017

2017-03-08T04:58:55Z

192.168.72.52 at 06:24, 14 May 2015

2015-05-14T06:24:55Z

Allen Tang: /* Expression */

2014-06-03T14:24:09Z

‎Expression

Allen Tang: /* References */

2014-06-03T14:23:23Z

‎References

Allen Tang: /* References */

2014-06-03T14:22:45Z

‎References

Allen Tang: /* Expression */

2014-06-03T14:19:21Z

‎Expression

Allen Tang: /* Expression */

2014-06-03T14:18:49Z

‎Expression

Allen Tang: /* Function */

2014-06-03T13:38:54Z

‎Function

124.16.129.48 at 19:07, 22 July 2012

2012-07-22T19:07:48Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os02g0121300| Description = Cyclophilin 2| Version = NM_001052252.1 GI:115443874 GeneID:4328121| Length = 887 bp| Definition = Oryza sativa Jap..."

2012-06-25T02:07:14Z

Created page with "{{JaponicaGene| GeneName = Os02g0121300| Description = Cyclophilin 2| Version = NM_001052252.1 GI:115443874 GeneID:4328121| Length = 887 bp| Definition = Oryza sativa Jap..."

New page

{{JaponicaGene|
GeneName = Os02g0121300|
Description = Cyclophilin 2|
Version = NM_001052252.1 GI:115443874 GeneID:4328121|
Length = 887 bp|
Definition = Oryza sativa Japonica Group Os02g0121300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:1116066..1116952|
CDS = 1116160..1116678|
GCID = <gbrowseImage1>
name=NC_008395:1116066..1116952
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:1116066..1116952
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctag</cdnaseq>|
AA = <aaseq>MSNTRVFFDMTVGGAPAGRIVMELYAKDVPRTAENFRALCTGEK GVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSP GILSMANAGPNTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGGSTA KPVVIADCGQLS</aaseq>|
DNA = <dnaseqindica>95..613#acgcagcgatctgaagtgaaacagcaaaaaaaatcaaacaaaaagaaaaaatattccccatctgtgaaattcgcaaaaccctagcgcggcggcgatgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctagatctgtgctgttccccttcgcctttcgccagtatcagtcgtcttgagtcgtcgagtccctaaataaggaggaggtggtggtggtgttagtctttttatgagttcgtgtcgtgttggtgagatgagatcgcccatggtttggttggattaggcggagttcttggatcgattcggtggagttggatctgcgatccttcttggggttggttttaaatcttaattcgtgtcgctgcttctatgatatcgctatcaatcaatgagaacatttgggatcc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052252.1 RefSeq:Os02g0121300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os02g0121300''''' was reported as '''''OsCYP2''''' in 2011 <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
 ===Function===
-Os02g0121300 is a cyclophilin gene.It encoding OsCYP2 protein,which interact with co-chaperone Suppressor of G2 allele of skp1(OsSGT1) to effect the process of the degradation of auxin-responsive proteins.It is important in rice lateral root initiation. Futhermore, another study shows that OsCYP2 expression can be induced by salt stress and circadian rhythm. And OsCYP2 able to control Reactive Oxygen Species(ROS) level as a modulator through mediate the activities of antioxidant enzymes at translation level.
+* '''''OsCYP2''''' is a cyclophilin gene.
 ===Expression===
-By the trial of qPCR,it is found that OsCYP2 expressed in various tissues, and GUS signal appeared in the root`s RAM region and lateral root`s RAM region. GUS signal appeared in the late stages of lateral root initiation, as well as both the crown and root primordia, leaves, vascular lemma(Kang et al. 2013).
+* '''''OsCYP2''''' expression is not only induced by salt stress, but also regulated by circadian rhythm.
+* Spatiotemporal expression analysis of '''''OsCYP2''''' showed that it could be induced by salt stress in both Shanyou 10 and Liangyoupeijiu seedlings, but Shanyou 10 seedlings showed higher OsCYP2 expression levels.
-''OsCYP2'' expression induced by salt stress and circadian rhythms.It is able to express in bud, but almost no expression in roots. In addition, ''OsCYP2'' circadian express in Shanyou 10 is earlier than in Liangyoupei 9. Using PEG, heat damage and seedling ABA treatment can induce the ''OsCYP2'' expression in seedling of shangyou 10.However,those treatment inhibit OsCYP2 expression in Liangyoupei 9.(Ruan et al. 2011).
+* Moreover, circadian rhythm expression of '''''OsCYP2''''' in Shanyou 10 seedlings occurred earlier than in Liangyoupeijiu seedlings.
+* Treatment with PEG, heat, or ABA induced '''''OsCYP2''''' expression in Shanyou 10 seedlings but inhibited its expression in Liangyoupeijiu seedlings. Cold stress inhibited OsCYP2 expression in Shanyou 10 and Liangyoupeijiu seedlings.
-===Evolution===
+* In addition, '''''OsCYP2''''' was strongly expressed in shoots but rarely in roots in two rice hybrid varieties.
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* Plant Molecular Biology & Proteomics Lab, Institute of Biotechnology, Hangzhou Academy of Agricultural Sciences, Hangzhou 310024, PR China.
+* National Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, PR China.
 ==References==
-[1]Bo Kang;Zhongchen Zhang;Lingling Wang;Libin Zheng;Weihua Mao;Meifei Li;Yunrong Wu;Ping Wu;Xiaorong Mo. OsCYP2, a chaperone involved in degradation of auxin-responsive proteins, plays crucial roles in rice lateral root initiation. The Plant Journal, 2013, 74(1): 86-97
+<references>
+* <ref name="ref1">
-[2]Song-Lin Ruan;Hua-Sheng Ma;Shi-Heng Wang;Ya-Ping Fu;Ya Xin;Wen-Zhen Liu;Fang Wang;Jian-Xin Tong;Shu-Zhen Wang;Hui-Zhe Chen.Proteomic identification of OsCYP2, a rice cyclophilin that confers salt tolerance in rice (Oryza sativa L.) seedlings when overexpressed.''BMC'' Plant Biology, 2011, 11: 34
+Ruan SL, Ma HS, Wang SH, Fu YP, Xin Y, Liu WZ, Wang F, Tong JX, Wang SZ, Chen
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

← Older revision		Revision as of 06:24, 14 May 2015
Line 24:		Line 24:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0121300\|~~
−	~~Description = Cyclophilin 2\|~~
−	~~Version = NM_001052252.1 GI:115443874 GeneID:4328121\|~~
−	~~Length = 887 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0121300, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:1116066..1116952\|~~
−	~~CDS = 1116160..1116678\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:1116066..1116952~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:1116066..1116952~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctag</cdnaseq>\|
−	AA = <aaseq>MSNTRVFFDMTVGGAPAGRIVMELYAKDVPRTAENFRALCTGEK GVGKSGKPLHYKGSTFHRVIPEFMCQGGDFTRGNGTGGESIYGEKFADEVFKFKHDSP GILSMANAGPNTNGSQFFICTVPCSWLDGKHVVFGRVVEGMDVVKAIEKVGSRGGSTA KPVVIADCGQLS</aaseq>\|
−	DNA = <dnaseqindica>95..613#acgcagcgatctgaagtgaaacagcaaaaaaaatcaaacaaaaagaaaaaatattccccatctgtgaaattcgcaaaaccctagcgcggcggcgatgtcgaacacgagggtgttcttcgacatgaccgtcggcggagctccggcggggcggatcgtgatggagctgtacgcgaaggacgtgccgcggacggcggagaacttccgcgcgctctgcaccggcgagaagggcgtgggcaagagcggcaagccgctgcactacaaggggagcaccttccaccgcgtgatcccggagttcatgtgccagggcggcgacttcacccgcggcaacggcacgggaggggagtcgatctacggcgagaagttcgccgacgaggtgttcaagttcaagcacgacagccccggcatcctgtccatggcgaacgccgggcccaacactaacgggtcccagttcttcatctgcaccgtgccctgcagctggctggacgggaagcacgtcgtgttcggccgcgtcgtcgagggcatggacgtcgtcaaggccatcgagaaggtgggatcccgcggcgggagcaccgccaagccggtcgtcatcgccgactgcggccagctctcctagatctgtgctgttccccttcgcctttcgccagtatcagtcgtcttgagtcgtcgagtccctaaataaggaggaggtggtggtggtgttagtctttttatgagttcgtgtcgtgttggtgagatgagatcgcccatggtttggttggattaggcggagttcttggatcgattcggtggagttggatctgcgatccttcttggggttggttttaaatcttaattcgtgtcgctgcttctatgatatcgctatcaatcaatgagaacatttgggatcc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052252.1 RefSeq:Os02g0121300]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 8: / Line 8: @@
 By the trial of qPCR,it is found that OsCYP2 expressed in various tissues, and GUS signal appeared in the root`s RAM region and lateral root`s RAM region. GUS signal appeared in the late stages of lateral root initiation, as well as both the crown and root primordia, leaves, vascular lemma(Kang et al. 2013).
-''OsCYP2'' expression induced by salt stress and circadian rhythms.It is able to express in bud, but almost no expression in roots. In addition, ''OsCYP2'' circadian express in Shanyou 10 is earlier than in Liangyoupei 9. Using PEG, heat damage and seedling ABA treatment can induce the ''OsCYP2'' expression in seedling of shangyou 10.However,those treatment inhibit OsCYP2 expression in Liangyoupei 9.(Ruan et al.) 2011).
+''OsCYP2'' expression induced by salt stress and circadian rhythms.It is able to express in bud, but almost no expression in roots. In addition, ''OsCYP2'' circadian express in Shanyou 10 is earlier than in Liangyoupei 9. Using PEG, heat damage and seedling ABA treatment can induce the ''OsCYP2'' expression in seedling of shangyou 10.However,those treatment inhibit OsCYP2 expression in Liangyoupei 9.(Ruan et al. 2011).
 ===Evolution===

@@ Line 20: / Line 20: @@
 ==References==
 [1]Bo Kang;Zhongchen Zhang;Lingling Wang;Libin Zheng;Weihua Mao;Meifei Li;Yunrong Wu;Ping Wu;Xiaorong Mo. OsCYP2, a chaperone involved in degradation of auxin-responsive proteins, plays crucial roles in rice lateral root initiation. The Plant Journal, 2013, 74(1): 86-97
 [2]Song-Lin Ruan;Hua-Sheng Ma;Shi-Heng Wang;Ya-Ping Fu;Ya Xin;Wen-Zhen Liu;Fang Wang;Jian-Xin Tong;Shu-Zhen Wang;Hui-Zhe Chen.Proteomic identification of OsCYP2, a rice cyclophilin that confers salt tolerance in rice (Oryza sativa L.) seedlings when overexpressed.''BMC'' Plant Biology, 2011, 11: 34

@@ Line 19: / Line 19: @@
 ==References==
-Please input cited references here.
+[1]Bo Kang;Zhongchen Zhang;Lingling Wang;Libin Zheng;Weihua Mao;Meifei Li;Yunrong Wu;Ping Wu;Xiaorong Mo. OsCYP2, a chaperone involved in degradation of auxin-responsive proteins, plays crucial roles in rice lateral root initiation. The Plant Journal, 2013, 74(1): 86-97
 ==Structured Information==

@@ Line 6: / Line 6: @@
 ===Expression===
-Please input expression information here.
+By the trial of qPCR,it found that OsCYP2 expressed in various tissues, and GUS signal appeared in the root`s RAM region and lateral root`s RAM region. GUS signal appeared in the late stages of lateral root initiation, as well as both the crown and root primordia, leaves, vascular lemma(Kang et al. 2013).
 ===Evolution===

← Older revision		Revision as of 19:07, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os02g0121300\|		GeneName = Os02g0121300\|