Os02g0181300 - Revision history

Xysj1981: /* Gene Symbol */

2017-03-08T04:49:44Z

‎Gene Symbol

Xysj1981 at 04:49, 8 March 2017

2017-03-08T04:49:25Z

Xysj2012: /* Structured Information */

2015-05-14T05:24:22Z

‎Structured Information

Hanweifang: /* Annotated Information */

2014-06-10T03:39:22Z

‎Annotated Information

Hanweifang: /* Expression */

2014-06-09T17:10:30Z

‎Expression

Hanweifang: /* Annotated Information */

2014-06-09T16:55:43Z

‎Annotated Information

Hanweifang: /* Function */

2014-06-09T16:34:15Z

‎Function

124.16.129.48 at 19:10, 22 July 2012

2012-07-22T19:10:09Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os02g0181300| Description = WRKY transcription factor 71 (Transcription factor WRKY09)| Version = NM_001052629.1 GI:115444628 GeneID:4328512| Le..."

2012-06-25T02:15:55Z

Created page with "{{JaponicaGene| GeneName = Os02g0181300| Description = WRKY transcription factor 71 (Transcription factor WRKY09)| Version = NM_001052629.1 GI:115444628 GeneID:4328512| Le..."

New page

{{JaponicaGene|
GeneName = Os02g0181300|
Description = WRKY transcription factor 71 (Transcription factor WRKY09)|
Version = NM_001052629.1 GI:115444628 GeneID:4328512|
Length = 1393 bp|
Definition = Oryza sativa Japonica Group Os02g0181300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:4543031..4544423|
CDS = 4543031..4543177,4543287..4543709,4543836..4543952,4544064..4544423|
GCID = <gbrowseImage1>
name=NC_008395:4543031..4544423
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:4543031..4544423
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</cdnaseq>|
AA = <aaseq>MDPWISTQPSLSLDLRVGLPATAAVAMVKPKVLVEEDFFHQQPL KKDPEVAALEAELKRMGAENRQLSEMLAAVAAKYEALQSQFSDMVTASANNGGGGGNN PSSTSEGGSVSPSRKRKSESLDDSPPPPPPPHPHAAPHHMHVMPGAAAAGYADQTECT SGEPCKRIREECKPKISKLYVHADPSDLSLVVKDGYQWRKYGQKVTKDNPCPRAYFRC SFAPACPVKKKVQRSAEDNTILVATYEGEHNHGQPPPPLQSAAQNSDGSGKSAGKPPH APAAAPPAPVVPHRQHEPVVVNGEQQAAAASEMIRRNLAEQMAMTLTRDPSFKAALVT ALSGRILELSPTKD</aaseq>|
DNA = <dnaseqindica>1..147#257..679#806..922#1034..1393#atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggtaggtcatgtgattaagcatacgtgcacggacgatcgacggccgccatggctgggagcgtgatgagcttaatttcttgagctgatttggggttttttttgttgtgaaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtacgaatccccaaccccaattaacatccgatcatctcatttcatgtgcctaacttaacttctttttgttctgaattctagccttgattaattaattaatcctgttcttgcaatgaatccatgcaggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggtaacttaaattcctctaactaattccaaagtgatttcgtaagttttgctaaatttagtgcaaattcgagcctgtttctgaactttgttcgtggttcaaatgttgtttcaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052629.1 RefSeq:Os02g0181300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

@@ Line 4: / Line 4: @@
 ===Gene Symbol===
 *'''''Os02g0181300''''' '''''<=>''''' '''''OsWRKY71''''','''''WRKY71'''''
 ===Function===

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os02g0181300''''' was reported as '''''OsWRKY71''''' in 2007 <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
 ===Function===
-WRKY proteins constitute a family of mostly plant-specific zinc-finger transcription factors composed of 74 and 109 members in Arabidopsis and rice, respectively.A common feature of WRKY proteins is the WRKY domain, which is defined by a region of approximately 60 amino acids containing a conserved WRKYGQK amino acid sequence adjacent to a zinc-finger-like motif.Both regions are necessary for high-affinity binding to a canonical Wb-box motif containing a consensus sequence (C/T)TGAC(C/T). Based on primary structure, WRKY proteins have been classified into three groups (I, II, and III) and various subgroups (e.g., IIa, IIb, etc.)
+* '''''OsWRKY71''''' might function in rice biotic stress response.
+* '''''OsWRKY71''''' might function as a transcriptional regulator upstream of OsNPR1 and OsPR1b in rice defense signaling pathways.
-== OsWRKY71 Proteins Are Targeted to Nuclei of Aleurone Cells ==
+===Phenotypic analysis===
-To investigate the subcellular localization of OsWRKY71 protein, the cDNA sequence of the OsWRKY71 gene was fused in frame to the 39 end of the green ﬂuorescent protein (GFP) gene that is driven by the constitutive maize Ubiquitin (UBI) promoter. The fusion construct, UBI-GFP:OsWRKY71 and the control construct UBI-GFP were introduced, respectively, into barley aleurone cells by bombardment. Confocal microscopic observations indicated that GFP ﬂuorescence was detected in the
+* To investigate the subcellular localization of OsWRKY71 protein, the cDNA sequence of the OsWRKY71 gene was fused in frame to the 39 end of the green ﬂuorescent protein (GFP) gene that is driven by the constitutive maize Ubiquitin (UBI) promoter.
-whole cell bombarded with the control construct UBIGFP. By contrast, the GFP:OsWRKY71 fusion protein was targeted to the nucleus. Aleurone cell nuclei were stained with SYTO17, which released red ﬂuorescence.
+* The fusion construct, UBI-GFP:OsWRKY71 and the control construct UBI-GFP were introduced, respectively, into barley aleurone cells by bombardment. Confocal microscopic observations indicated that GFP ﬂuorescence was detected in the whole cell bombarded with the control construct UBIGFP.
 ===Expression===
-The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR. To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers. Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls. Four transgenic lines showed silencing of all four genes, called supersilencing, as expected, and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
+* '''''OsWRKY71''''' was up-regulated by several defense signaling molecules, such as SA, methyl jasmonate (MeJA), 1-aminocyclo-propane-1-carboxylic acid (ACC), as well as wounding and pathogen infection.
 ===Evolution===
-OsWRKY IIa subfamily members play both positive and negative regulatory roles in regulating plant innate immunity. Overexpression of OsWRKY62 compromises rice
+* WRKY proteins are a large family of transcription factors that mainly participate in plant biotic stress responses.
-basal defense and Xa21-mediated resistance to Xoo. By contrast, overexpression of OsWRKY71 results in elevated expression of defense-related genes and
+* So far, one hundred and five OsWRKY genes have been predicted in the rice genome.
-enhanced resistance to Xoo. The work presented here demonstrates that super-overexpression of OsWRKY IIa subfamily members enhances basal defenseagainst Xoo. These data indicate functional interactions between OsWRKY IIa proteins in regulating plant innate immunity. Yeast two-hybrid and bimolecular fluorescence
+* OsWRKY IIa subfamily members play both positive and negative regulatory roles in regulating plant innate immunity.
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* National Key Laboratory of Plant Genomics and Plant Gene Research Center (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Datun Road, Beijing 100101, China
 ==References==
-Please input cited references here.
+<references>
+* <ref name="ref1">
 ==Structured Information==

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-WRKY proteins constitute a family of mostly plant-specific zinc-finger transcription factors composed of 74 and 109 members in Arabidopsis and rice, respectively.A common feature of WRKY proteins is the WRKY domain, which is defined by a region of approximately 60 amino acids containing a conserved WRKYGQK amino acid sequence adjacent to a zinc-finger-like motif.Both regions are necessary for high-affinity binding to a canonical Wb-box motif containing a consensus sequence (C/T)TGAC
+WRKY proteins constitute a family of mostly plant-specific zinc-finger transcription factors composed of 74 and 109 members in Arabidopsis and rice, respectively.A common feature of WRKY proteins is the WRKY domain, which is defined by a region of approximately 60 amino acids containing a conserved WRKYGQK amino acid sequence adjacent to a zinc-finger-like motif.Both regions are necessary for high-affinity binding to a canonical Wb-box motif containing a consensus sequence (C/T)TGAC(C/T). Based on primary structure, WRKY proteins have been classified into three groups (I, II, and III) and various subgroups (e.g., IIa, IIb, etc.)
 (C/T). Based on primary structure, WRKY proteins have been classified into three groups (I, II, and III) and various subgroups (e.g., IIa, IIb, etc.)
 ===Expression===
-The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
+The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR. To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers. Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls. Four transgenic lines showed silencing of all four genes, called supersilencing, as expected, and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
 ===Evolution===
-Please input evolution information here.
+OsWRKY IIa subfamily members play both positive and negative regulatory roles in regulating plant innate immunity. Overexpression of OsWRKY62 compromises rice
 You can also add sub-section(s) at will.

@@ Line 8: / Line 8: @@
 ===Expression===
 The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
 ===Evolution===

@@ Line 7: / Line 7: @@
 ===Expression===
-Please input expression information here.
+The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
 ===Evolution===

@@ Line 44: / Line 44: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

← Older revision		Revision as of 19:10, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os02g0181300\|		GeneName = Os02g0181300\|