Os02g0202000 - Revision history

Zhennan at 08:04, 23 March 2017

2017-03-23T08:04:46Z

192.168.72.52 at 06:29, 14 May 2015

2015-05-14T06:29:54Z

Zhxbin2008: /* References */

2014-06-09T12:09:18Z

‎References

Zhxbin2008: /* Annotated Information */

2014-06-09T12:07:49Z

‎Annotated Information

Zhxbin2008: /* References */

2014-06-09T12:07:33Z

‎References

Zhxbin2008: /* Annotated Information */

2014-06-09T12:06:20Z

‎Annotated Information

Zhxbin2008: /* References */

2014-06-09T12:05:39Z

‎References

Zhxbin2008: /* References */

2014-06-09T12:04:15Z

‎References

Zhxbin2008: /* References */

2014-06-09T11:55:34Z

‎References

Zhxbin2008: /* Labs working on this gene */

2014-06-09T11:51:33Z

‎Labs working on this gene

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os02g0202000''''' was reported as '''''OsERF#003''''' in 2006 <ref name="ref1" /> by researchers from Japan.
 ==Annotated Information==
 ===Function===
+* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
-Transcript analysis showed that OsWR1 is induced by drought, abscisic acid and salt, and is predominantly expressed in leaves. Functional analyses indicated that over expressing OsWR1 improved while RNA interference OsWR1 rice decreased drought tolerance, consistent with water loss and cuticular permeability, suggesting that OsWR1-triggered drought response might be associated with cuticular characteristics. In addition, OsWR1 activated the expression of the genes-related to oxidative stress response and membrane stability. Gas chromatograph–mass spectrometry analysis further showed that OsWR1 modulated the wax synthesis through alteration of long chain fatty acids and alkanes, evidencing the regulation of OsWR1 in wax synthesis. This WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.
+* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
+* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
 ===Evolution===
-[[File:Fig-1.jpg|right|thumb|150px|''Sequence analysis of OsWR1 with WIN1-like.A: Whole amino acid sequence comparison of WIN1-like from Arabidopsis and rice. Asterisks represent the putative domain of the nuclear localization signal, the black line indicates the highly conserved AP2 domain, and double black lines indicate the putative activation domain. The shaded boxes indicate the percentage of sequences at this position with the same amino acid identity: black, 100%; and gray, 75%. Protein names are indicated at the left. B: Nucleotide sequences comparison derived from sequence alignment of ERF whole regions from Arabidopsis and rice'']]
+You can also add sub-section(s) at will.
 ==Labs working on this gene==
 ==References==
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

← Older revision		Revision as of 06:29, 14 May 2015
Line 27:		Line 27:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0202000\|~~
−	~~Description = Pathogenesis-related transcriptional factor and ERF domain containing protein\|~~
−	~~Version = NM_001052761.2 GI:297598782 GeneID:4328653\|~~
−	~~Length = 1051 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0202000, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:5688756..5689806\|~~
−	~~CDS = 5688851..5688933,5689055..5689589\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:5688756..5689806~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:5688756..5689806~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggtacagccaaagaagaagtttcgtggagtcaggcagcggcactggggctcctgggtctctgagatcagacaccccctccttaaaaggagggtgtggctgggcacctttgagacggccgaggaggctgcgcgagcctacgatgaggctgctgtgctgatgagtggccgcaacgccaagaccaacttccccgtgcagaggaactccaccggtgatctcgccacggccgcagaccaggacgcccgtagcaatggcggtagcaggaactcctccgcgggcaacctgtcacagattctcagtgctaagctccgcaagtgctgcaaggcgccatctccgtccttaacctgcctccgcctcgaccccgagaagtcccacattggcgtgtggcaaaagcgcgcaggggcccgtgctgactccaactgggtgatgacggtggagctcaacaaagaggtagaaccaactgaacctgcagctcagcccacatcaacagcaacagcttcgcaagtgacaatggatgatgaggaaaagattgcgctgcaaatgatcgaggagttgctgagcaggagcagtccagcttcaccctcacatggagagggagagggtagctttgtcatctga</cdnaseq>\|
−	AA = <aaseq>MVQPKKKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAA RAYDEAAVLMSGRNAKTNFPVQRNSTGDLATAADQDARSNGGSRNSSAGNLSQILSAK LRKCCKAPSPSLTCLRLDPEKSHIGVWQKRAGARADSNWVMTVELNKEVEPTEPAAQP TSTATASQVTMDDEEKIALQMIEELLSRSSPASPSHGEGEGSFVI</aaseq>\|
−	DNA = <dnaseqindica>96..178#300..834#gttcagttcagaggcgcctagcaatagcagctcattgcctcatctctgcctcccctgtccttctgggggcagagaatctctccactgctggaaaaatggtacagccaaagaagaagtttcgtggagtcaggcagcggcactggggctcctgggtctctgagatcagacaccccctcctgtaagctcttctatcaacatccctctaattttctgctaataatgttatgttttgatgtgtctaatactctaatctaataagtaataagtctcaatgcatatggtgtttgcaactaatgcagtaaaaggagggtgtggctgggcacctttgagacggccgaggaggctgcgcgagcctacgatgaggctgctgtgctgatgagtggccgcaacgccaagaccaacttccccgtgcagaggaactccaccggtgatctcgccacggccgcagaccaggacgcccgtagcaatggcggtagcaggaactcctccgcgggcaacctgtcacagattctcagtgctaagctccgcaagtgctgcaaggcgccatctccgtccttaacctgcctccgcctcgaccccgagaagtcccacattggcgtgtggcaaaagcgcgcaggggcccgtgctgactccaactgggtgatgacggtggagctcaacaaagaggtagaaccaactgaacctgcagctcagcccacatcaacagcaacagcttcgcaagtgacaatggatgatgaggaaaagattgcgctgcaaatgatcgaggagttgctgagcaggagcagtccagcttcaccctcacatggagagggagagggtagctttgtcatctgaaaggcttggatgaaacgacggcataacgaagtcaccactctagaccatggttccagaatttcctgctggtacacaggcagttcagattacttcagtacaatagaaaatatctattacttcagacaagtaacaagacatataagtttgcaactatgtgtagctatatgtgtttatgaaaagctatatatacgcagtctccatcaacatactttgttac</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052761.2 RefSeq:Os02g0202000]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 23: / Line 23: @@
 ==References==
-[1]
-<references>
+Wang, Y., et al. (2012). "An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice." Plant Mol Biol 78(3): 275-288.
 ==Structured Information==

@@ Line 3: / Line 3: @@
 ==Annotated Information==
-The ethylene response factor (ERF) gene WIN1/SHN1 was shown to transcriptionally activate the expression of wax synthesis genes and wax production, resulting in drought tolerance in Arabidopsis. To further investigate the regulation of ERF proteins in rice, we started with homology search for rice genes in the National Center of Biological Informatics using the Arabidopsis WIN1/SHN1 as a probe and found 4 rice orthologues with high amino acid identities in N-terminal region. These rice WIN1-like genes, named rice wax synthesis regulator (OsWR), all encode ERF proteins that contain a basic N-terminal region that might function as an nuclear localization signal and an acidic C-terminal region that might act as an activation domain for transcription. OsWR1 (Os02g0202000) is one of them[1].
+The ethylene response factor (ERF) gene WIN1/SHN1 was shown to transcriptionally activate the expression of wax synthesis genes and wax production, resulting in drought tolerance in Arabidopsis. To further investigate the regulation of ERF proteins in rice, we started with homology search for rice genes in the National Center of Biological Informatics using the Arabidopsis WIN1/SHN1 as a probe and found 4 rice orthologues with high amino acid identities in N-terminal region. These rice WIN1-like genes, named rice wax synthesis regulator (OsWR), all encode ERF proteins that contain a basic N-terminal region that might function as an nuclear localization signal and an acidic C-terminal region that might act as an activation domain for transcription. OsWR1 (Os02g0202000) is one of them.
 ===Function===

@@ Line 23: / Line 23: @@
 ==References==
+[1]
 <references>
 <ref name="ref1">Wang, Y., et al. (2012). "An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice." Plant Mol Biol 78(3): 275-288.</ref>