Os02g0203500 - Revision history

192.168.72.52 at 06:30, 14 May 2015

2015-05-14T06:30:03Z

YinQi: /* Expression */

2014-06-09T16:03:02Z

‎Expression

YinQi: /* Expression */

2014-06-09T15:36:01Z

‎Expression

YinQi: /* Expression */

2014-06-09T15:35:22Z

‎Expression

YinQi: /* Function */

2014-06-09T15:25:59Z

‎Function

YinQi: /* Function */

2014-06-09T15:23:31Z

‎Function

YinQi: /* Function */

2014-06-09T13:06:06Z

‎Function

YinQi: /* Function */

2014-06-09T13:04:29Z

‎Function

YinQi: /* Evolution */

2014-06-09T13:02:19Z

‎Evolution

YinQi: /* Expression */

2014-06-09T13:01:12Z

‎Expression

← Older revision		Revision as of 06:30, 14 May 2015
Line 56:		Line 56:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0203500\|~~
−	~~Description = Disease resistance protein family protein\|~~
−	~~Version = NM_001052774.2 GI:297598786 GeneID:4328665\|~~
−	~~Length = 3672 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0203500, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:5785295..5788966\|~~
−	~~CDS = 5785295..5787370,5787723..5788797,5788881..5788966\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:5785295..5788966~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:5785295..5788966~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggttggtgatgtcgaggttgatgaaggaacgggaccggaggattcggtgttggagttggtggcggccaggagaacgcacgccattggtttgtttgaccggaagcgaggccatatggatgctgtgaatgttcttgcctcggcgacccagctggtgtccgcgatgctcaccgcggtcggcgcgctggagcaggcggctgccgacttcgccgaggctcccaggaggctccaggttcttgaggattttgtgtccgaccttgggctgttgatgcagcaatccaagcagaagcacgcgcacaagatgcacgcgccgcagctcgagcgtcagctccagagcctaggcaagctgatggaccagctccatgccaacatcacaaaggcgaggcgggtgttgaagaaaggcaaagggaagaagggcttggccagagttgtgtggagctcggtgacaggggaccctctgatgaagtatgttcagctgatcagggatgatctcaactggtggcttgagttacagaagctaacagagagtgtgggcaatgtcatagcgtctacagctaagagtacgccatccttggtgagagtcaagtcggagcatggctatccagtgtcaaagaagtgcagctatgtcagggagctgcttatcaatgatggtagtcatcgagttgtcctgattgtcgggttatctggtattgggaagtcgtgtcttgctcgacaaatagcttctgacccgcctggtaattttgtggatggtgcaattgagcttagttttgggcggtggtgcagtagagcggcatgcaatggtaatagggatgaataccacaagcgtcttgttcggaaaatatgtaaatttcttgtgcagattggttccatgactgtcaatgaggatgtgggcaaagatcttgaagatgtctgttacttgcttcagactgcattggtaggaaggagcatgctgatcctacttgatgatgtctgggagcaagacatagttgatcgcttcacaaacctatatgataatgattgccggtatcttgtgacaacgagggatgaggcaatttatgagattgcagaagctgaaaaggtggaaatatccaaagatgatatcaaagaaattggcaaggacattcttctctatcatagccttcttactgttgaagagctcccgcctgttgcgtacgacttgctggatcgttgcggccaccatccccttacagttgctgtcatgggtaaggctctcagaaaggagaccagagtcgaaaaatgggatagagcaatctccaacctttccacatatgcaacttgtgcacctggaccggtttcatatgtgaatgagaaagaagtggaaaccacattgaccatctttgggtcttttgagttcagcttagaagcaatgccagaaaattcaagaaggtttttcatggtgcttgcagctatctcatgggatgaacctgttccagaggcttgccttgaatccatgtggtcagcactcatgcaggacactttattccccctcgtggtctcgaaactagtagaaggctcactcattatcaaactggaagaccaatcgatgtatcatatgcatgacatggtttcgctttacctcgagagtaaaacagacaacgctgttcatactcttttgttcggttcatttcctgaatatgctgcattggtgtctccttggcttttcatttttggcaaagagagcgcaaaagagcgagctgaacagaagataagatcattattttctttgctagagttcatggagatagagattttactaggaagcaccacccaagctctcatggaatgcaaatccatatctgaatttgaggctagcaggcttcacttcagcaaaatacttagtcctcgaatagcggagttaatttctgtggggtcaacatctctcattgttactgtcaccaaatctattacagtaatctttttccaaggagattatgctaagcttgctcagtctcttgaaacagcaggttctgtggataaattaattcatgttcttcgtggctgtgaagattcttctactctagccaatgtttctactgttcttgccaagatatctgagcatgttgatgctacaactgctgatgaaattttggcaaccattcctatggaccaaattgcgaaattactctctcctgagaatgaagaatggcatgaaattgtgtttacaactctagcatctttgataaaggtgggaaagttaagggctgttgagacaatgatcgaatcaggaattgacaagaagcttcttgttcttctaggcagtggttctgagatctcacagcatcatgcgattatcatgctaaaaacattctgtgaacttggtgcgccacttcaggggtgcatgggacctggagcgttgactcatttgccttggcatgctcgtctcagtttggagagatttgttttatttgaccaaaatgtaactccatcaccaaagcctcaacaatcttttgagttgattcttcacaagatactgcacagagacaacaaagataacattgaggcgatccaaggtttattacctctcgctgagagggctaatgattcaagggtgcaagatctccttttgggaagcaatatgtccaatgggttggcactgctgctgcaacggagagacattgaaagcaaccaagtgaggtctcacactgcttttctggtgatgaaattagcctgcactggaggggaaccatatgtccataggttcttagaggctaacattgttcatgagctaattgacatgatgcagtgcaacatcaacgatctccaggattcagcatactatgcccttcaccagattatctttgcgaaggggggatcacttgtattacagagatttttacaagcaggaaccattgaaaaattggttaacttgcttgaccgcaagtcttcaaagacaaaggaactaacaatgcagcttctggtagacattgcggtggtcggaaccaaaccttgcatcgaaagaatgctctcgtcccaaatcatcgagaaatttgtggcactcgagaaagcaggtgggtctttcagtggagcggtatcaagatacgtgcaggggttgaacatgtgcaagaacgtccagtctgctgagagatcagtcatgaagcaacagattctgaggaaagtgagatcagagataagaggtcatgatctggaagcaagtctagttgcctctgtggaagcttgcatttctgaaaaaggagccagcagcaggaggaaaaagtag</cdnaseq>\|
−	AA = <aaseq>MVGDVEVDEGTGPEDSVLELVAARRTHAIGLFDRKRGHMDAVNV LASATQLVSAMLTAVGALEQAAADFAEAPRRLQVLEDFVSDLGLLMQQSKQKHAHKMH APQLERQLQSLGKLMDQLHANITKARRVLKKGKGKKGLARVVWSSVTGDPLMKYVQLI RDDLNWWLELQKLTESVGNVIASTAKSTPSLVRVKSEHGYPVSKKCSYVRELLINDGS HRVVLIVGLSGIGKSCLARQIASDPPGNFVDGAIELSFGRWCSRAACNGNRDEYHKRL VRKICKFLVQIGSMTVNEDVGKDLEDVCYLLQTALVGRSMLILLDDVWEQDIVDRFTN LYDNDCRYLVTTRDEAIYEIAEAEKVEISKDDIKEIGKDILLYHSLLTVEELPPVAYD LLDRCGHHPLTVAVMGKALRKETRVEKWDRAISNLSTYATCAPGPVSYVNEKEVETTL TIFGSFEFSLEAMPENSRRFFMVLAAISWDEPVPEACLESMWSALMQDTLFPLVVSKL VEGSLIIKLEDQSMYHMHDMVSLYLESKTDNAVHTLLFGSFPEYAALVSPWLFIFGKE SAKERAEQKIRSLFSLLEFMEIEILLGSTTQALMECKSISEFEASRLHFSKILSPRIA ELISVGSTSLIVTVTKSITVIFFQGDYAKLAQSLETAGSVDKLIHVLRGCEDSSTLAN VSTVLAKISEHVDATTADEILATIPMDQIAKLLSPENEEWHEIVFTTLASLIKVGKLR AVETMIESGIDKKLLVLLGSGSEISQHHAIIMLKTFCELGAPLQGCMGPGALTHLPWH ARLSLERFVLFDQNVTPSPKPQQSFELILHKILHRDNKDNIEAIQGLLPLAERANDSR VQDLLLGSNMSNGLALLLQRRDIESNQVRSHTAFLVMKLACTGGEPYVHRFLEANIVH ELIDMMQCNINDLQDSAYYALHQIIFAKGGSLVLQRFLQAGTIEKLVNLLDRKSSKTK ELTMQLLVDIAVVGTKPCIERMLSSQIIEKFVALEKAGGSFSGAVSRYVQGLNMCKNV QSAERSVMKQQILRKVRSEIRGHDLEASLVASVEACISEKGASSRRKK</aaseq>\|
−	DNA = <dnaseqindica>1597..3672#170..1244#1..86#atggttggtgatgtcgaggttgatgaaggaacgggaccggaggattcggtgttggagttggtggcggccaggagaacgcacgccatgtgttcgtcggattgtcgcagccagctctgagtattgaattcttgctaggggagagattggagcttcgttgctgttgctctagtggtttgtttgaccggaagcgaggccatatggatgctgtgaatgttcttgcctcggcgacccagctggtgtccgcgatgctcaccgcggtcggcgcgctggagcaggcggctgccgacttcgccgaggctcccaggaggctccaggttcttgaggattttgtgtccgaccttgggctgttgatgcagcaatccaagcagaagcacgcgcacaagatgcacgcgccgcagctcgagcgtcagctccagagcctaggcaagctgatggaccagctccatgccaacatcacaaaggcgaggcgggtgttgaagaaaggcaaagggaagaagggcttggccagagttgtgtggagctcggtgacaggggaccctctgatgaagtatgttcagctgatcagggatgatctcaactggtggcttgagttacagaagctaacagagagtgtgggcaatgtcatagcgtctacagctaagagtacgccatccttggtgagagtcaagtcggagcatggctatccagtgtcaaagaagtgcagctatgtcagggagctgcttatcaatgatggtagtcatcgagttgtcctgattgtcgggttatctggtattgggaagtcgtgtcttgctcgacaaatagcttctgacccgcctggtaattttgtggatggtgcaattgagcttagttttgggcggtggtgcagtagagcggcatgcaatggtaatagggatgaataccacaagcgtcttgttcggaaaatatgtaaatttcttgtgcagattggttccatgactgtcaatgaggatgtgggcaaagatcttgaagatgtctgttacttgcttcagactgcattggtaggaaggagcatgctgatcctacttgatgatgtctgggagcaagacatagttgatcgcttcacaaacctatatgataatgattgccggtatcttgtgacaacgagggatgaggcaatttatgagattgcagaagctgaaaaggtggaaatatccaaagatgatatcaaagaaattggcaaggacattcttctctatcatagccttcttactgttgaagagctcccggtatactcttctatttgcatctttcatggttactgaatactcctgcactttagcctattttagttttacctgataaaattgttttgcaccctgcagctaaggtatcatcttcatgtggattgtatatgtgtttacatttcaacattggtttcgttttaatatccttcatgtttaacatggaaagtacacaaatatagttagccaactatttatattcatgttagtctacttaaagtaattagttatatgtgtatctgtcatacaagagatgttcaatatgtaacttagaacttagaactactaaagacctagttttatgggtttgtatggttaacattcctgttctttacagcctgttgcgtacgacttgctggatcgttgcggccaccatccccttacagttgctgtcatgggtaaggctctcagaaaggagaccagagtcgaaaaatgggatagagcaatctccaacctttccacatatgcaacttgtgcacctggaccggtttcatatgtgaatgagaaagaagtggaaaccacattgaccatctttgggtcttttgagttcagcttagaagcaatgccagaaaattcaagaaggtttttcatggtgcttgcagctatctcatgggatgaacctgttccagaggcttgccttgaatccatgtggtcagcactcatgcaggacactttattccccctcgtggtctcgaaactagtagaaggctcactcattatcaaactggaagaccaatcgatgtatcatatgcatgacatggtttcgctttacctcgagagtaaaacagacaacgctgttcatactcttttgttcggttcatttcctgaatatgctgcattggtgtctccttggcttttcatttttggcaaagagagcgcaaaagagcgagctgaacagaagataagatcattattttctttgctagagttcatggagatagagattttactaggaagcaccacccaagctctcatggaatgcaaatccatatctgaatttgaggctagcaggcttcacttcagcaaaatacttagtcctcgaatagcggagttaatttctgtggggtcaacatctctcattgttactgtcaccaaatctattacagtaatctttttccaaggagattatgctaagcttgctcagtctcttgaaacagcaggttctgtggataaattaattcatgttcttcgtggctgtgaagattcttctactctagccaatgtttctactgttcttgccaagatatctgagcatgttgatgctacaactgctgatgaaattttggcaaccattcctatggaccaaattgcgaaattactctctcctgagaatgaagaatggcatgaaattgtgtttacaactctagcatctttgataaaggtgggaaagttaagggctgttgagacaatgatcgaatcaggaattgacaagaagcttcttgttcttctaggcagtggttctgagatctcacagcatcatgcgattatcatgctaaaaacattctgtgaacttggtgcgccacttcaggggtgcatgggacctggagcgttgactcatttgccttggcatgctcgtctcagtttggagagatttgttttatttgaccaaaatgtaactccatcaccaaagcctcaacaatcttttgagttgattcttcacaagatactgcacagagacaacaaagataacattgaggcgatccaaggtttattacctctcgctgagagggctaatgattcaagggtgcaagatctccttttgggaagcaatatgtccaatgggttggcactgctgctgcaacggagagacattgaaagcaaccaagtgaggtctcacactgcttttctggtgatgaaattagcctgcactggaggggaaccatatgtccataggttcttagaggctaacattgttcatgagctaattgacatgatgcagtgcaacatcaacgatctccaggattcagcatactatgcccttcaccagattatctttgcgaaggggggatcacttgtattacagagatttttacaagcaggaaccattgaaaaattggttaacttgcttgaccgcaagtcttcaaagacaaaggaactaacaatgcagcttctggtagacattgcggtggtcggaaccaaaccttgcatcgaaagaatgctctcgtcccaaatcatcgagaaatttgtggcactcgagaaagcaggtgggtctttcagtggagcggtatcaagatacgtgcaggggttgaacatgtgcaagaacgtccagtctgctgagagatcagtcatgaagcaacagattctgaggaaagtgagatcagagataagaggtcatgatctggaagcaagtctagttgcctctgtggaagcttgcatttctgaaaaaggagccagcagcaggaggaaaaagtag</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052774.2 RefSeq:Os02g0203500]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 22: / Line 22: @@
 . RLS1 expression Is affected by dark-induced senescence and Cytokinin treatment. The expression of RLS1 was significantly induced in the seedlings transferred into darkness and reached the maximum level 12 h after treatment (Figure2). Accumulation of the RLS1 transcript was markedly reduced in the seedlings treated with 20 lM trans-zeatin (tZ) for 24 h (Figure1). These results suggested that RLS1 is involved in leaf senescence.<ref name="ref1" /> [[File:RLS1.1.png|none|300px]]     (figure2)<ref name="ref1" />
-. The expression profile of RLS1 was investigated in various rice tissues at the adult stage with the quantitative real-time PCR approach. The results showed that RLS1 transcripts accumulated constitutively during leaf development, from young to senescent leaves (Figure 1). In addition, RLS1 was constitutively but
+. The expression profile of RLS1 was investigated in various rice tissues at the adult stage with the quantitative real-time PCR approach. The results showed that RLS1 transcripts accumulated constitutively during leaf development, from young to senescent leaves (Figure 2). In addition, RLS1 was constitutively but
 weakly expressed in the root of seedling, panicle, and spikelet. The highest level of the RLS1 transcript was detected in mature leaves, consistent with the phenotype of rls1.<ref name="ref1" />

@@ Line 18: / Line 18: @@
 ===Expression===
-.There is only one copy of the RLS1 gene in the rice genome. The RLS1 homolog genes with unknown function were only found in sorghum, grape, and black cottonwood by a BLAST search. The putative NB domain of RLS1 contains the conserved motifs found in a large number of proteins binding ATP or GTP, and shows a significant similarity to that of homologous proteins from sorghum, grape, and black cottonwood.<ref name="ref1" /> Genetic studies have provided evidence that NB-containing R proteins in plant, such as RPS4, RPM1, can activate cell death during HR execution (Hofius et al., 2009).<ref name="ref2" />
+.There is only one copy of the RLS1 gene in the rice genome. The RLS1 homolog genes with unknown function were only found in sorghum, grape, and black cottonwood by a BLAST search. The putative NB domain of RLS1 contains the conserved motifs found in a large number of proteins binding ATP or GTP, and shows a significant similarity to that of homologous proteins from sorghum, grape, and black cottonwood. Genetic studies have provided evidence that NB-containing R proteins in plant, such as RPS4, RPM1, can activate cell death during HR execution (Hofius et al., 2009<ref name="ref2" />).<ref name="ref1" />
 . RLS1 expression Is affected by dark-induced senescence and Cytokinin treatment. The expression of RLS1 was significantly induced in the seedlings transferred into darkness and reached the maximum level 12 h after treatment (Figure2). Accumulation of the RLS1 transcript was markedly reduced in the seedlings treated with 20 lM trans-zeatin (tZ) for 24 h (Figure1). These results suggested that RLS1 is involved in leaf senescence.<ref name="ref1" /> [[File:RLS1.1.png|none|300px]]     (figure2)<ref name="ref1" />

@@ Line 20: / Line 20: @@
 .There is only one copy of the RLS1 gene in the rice genome. The RLS1 homolog genes with unknown function were only found in sorghum, grape, and black cottonwood by a BLAST search. The putative NB domain of RLS1 contains the conserved motifs found in a large number of proteins binding ATP or GTP, and shows a significant similarity to that of homologous proteins from sorghum, grape, and black cottonwood.<ref name="ref1" /> Genetic studies have provided evidence that NB-containing R proteins in plant, such as RPS4, RPM1, can activate cell death during HR execution (Hofius et al., 2009).<ref name="ref2" />
-. RLS1 expression Is affected by dark-induced senescence and Cytokinin treatment.<ref name="ref1" /> The expression of RLS1 was significantly induced in the seedlings transferred into darkness and reached the maximum level 12 h after treatment (Figure2). Accumulation of the RLS1 transcript was markedly reduced in the seedlings treated with 20 lM trans-zeatin (tZ) for 24 h (Figure1). These results suggested that RLS1 is involved in leaf senescence.<ref name="ref1" /> [[File:RLS1.1.png|none|300px]]     (figure2)<ref name="ref1" />
+. RLS1 expression Is affected by dark-induced senescence and Cytokinin treatment. The expression of RLS1 was significantly induced in the seedlings transferred into darkness and reached the maximum level 12 h after treatment (Figure2). Accumulation of the RLS1 transcript was markedly reduced in the seedlings treated with 20 lM trans-zeatin (tZ) for 24 h (Figure1). These results suggested that RLS1 is involved in leaf senescence.<ref name="ref1" /> [[File:RLS1.1.png|none|300px]]     (figure2)<ref name="ref1" />
 . The expression profile of RLS1 was investigated in various rice tissues at the adult stage with the quantitative real-time PCR approach. The results showed that RLS1 transcripts accumulated constitutively during leaf development, from young to senescent leaves (Figure 1). In addition, RLS1 was constitutively but

@@ Line 11: / Line 11: @@
 .Consistent with its involvement in leaf senescence, RLS1 was up-regulated during dark-induced leaf senescence and down-regulated by cytokinin.<ref name="ref1" />
-.Intriguingly, constitutive expression of RLS1 also slightly accelerated leaf senescence with decreased chlorophyll content in transgenic rice plants.The rls1 mutant plants showed accelerated leaf senescence under both natural and dark-induced conditions(Figure 1A, 1C, and 1D） . Therefore, the accelerated senescence of the rls1 mutant appears not to be directly induced by the formation of spontaneous lesions.the rapid loss of chlorophyll was the main cause of accelerated leaf senescence in rls1.<ref name="ref1" />[[File:RLS1.00.png|none|300px]]  [[File:RLS1.0.png|none|300px]]   (figure1)<ref name="ref1" />
+.Intriguingly, constitutive expression of RLS1 also slightly accelerated leaf senescence with decreased chlorophyll content in transgenic rice plants.The rls1 mutant plants showed accelerated leaf senescence under both natural and dark-induced conditions(Figure 1A, 1C, and 1D） . Therefore, the accelerated senescence of the rls1 mutant appears not to be directly induced by the formation of spontaneous lesions.The rapid loss of chlorophyll was the main cause of accelerated leaf senescence in rls1.<ref name="ref1" />[[File:RLS1.00.png|none|300px]]  [[File:RLS1.0.png|none|300px]]   (figure1)<ref name="ref1" />
 . The RLS1 gene might be involved in PCD that affects specific cellular processes.previously uncharacterized NB–ARM protein involved in PCD during plant growth and development, providing a unique tool for dissecting possible autophagymediated PCD during senescence in plants.<ref name="ref1" />

@@ Line 11: / Line 11: @@
 .Consistent with its involvement in leaf senescence, RLS1 was up-regulated during dark-induced leaf senescence and down-regulated by cytokinin.<ref name="ref1" />
-.Intriguingly, constitutive expression of RLS1 also slightly accelerated leaf senescence with decreased chlorophyll content in transgenic rice plants.The rls1 mutant plants showed accelerated leaf senescence under both natural and dark-induced conditions(Figure 1C, 1D, and 1A . Therefore, the accelerated senescence of the rls1 mutant appears not to be directly induced by the formation of spontaneous lesions.the rapid loss of chlorophyll was the main cause of accelerated leaf senescence in rls1<ref name="ref1" />[[File:RLS1.00.png|none|300px]]  [[File:RLS1.0.png|none|300px]]   (figure1)<ref name="ref1" />
+.Intriguingly, constitutive expression of RLS1 also slightly accelerated leaf senescence with decreased chlorophyll content in transgenic rice plants.The rls1 mutant plants showed accelerated leaf senescence under both natural and dark-induced conditions(Figure 1A, 1C, and 1D） . Therefore, the accelerated senescence of the rls1 mutant appears not to be directly induced by the formation of spontaneous lesions.the rapid loss of chlorophyll was the main cause of accelerated leaf senescence in rls1<ref name="ref1" />[[File:RLS1.00.png|none|300px]]  [[File:RLS1.0.png|none|300px]]   (figure1)<ref name="ref1" />
 . the RLS1 gene might be involved in PCD that affects specific cellular processes.previously uncharacterized NB–ARM protein involved in PCD during plant growth and development, providing a unique tool for dissecting possible autophagymediated PCD during senescence in plants.<ref name="ref1" />

@@ Line 30: / Line 30: @@
 ===Evolution===
-.The putative NB domain of RLS1 contains the conserved motifs found in a large number of proteins binding ATP or GTP, and shows a significant similarity to that of homologous proteins from sorghum, grape, and black cottonwood. Moreover, it is also similar (23–30% similarity) to those of various NB-containing R proteins (Figure 3A). We then assessed the sequence diversity of the selected homologs, by generating a phylogenetic tree using the NB sequences (Figure 3B)The NB domains from 10 amino acids N-terminal to the first Gly in the Kinase 1a motif to 10 amino acids beyond the kinase 3amotif were used for analysis.Intriguingly, RLS1 was more closely related to the CC-NB-LRR proteins, Rx, I2, R3a (Moffett et al., 2002<ref name="ref3" />; Couch et al., 2006<ref name="ref4" />; Jia et al., 2010<ref name="ref5" />)than to TIR-NB-LRR proteins, N, RRS1-R, CHS3 (Deslandes et al., 2002<ref name="ref6" />; Konagaya et al., 2004<ref name="ref7" />; Yang et al., 2010<ref name="ref8" />).<ref name="ref1" />[[File:RLS1.5A.png|none|300px]][[File:RLS1.5B.png|none|300px]]    (figure3) <ref name="ref1" />
+.The putative NB domain of RLS1 contains the conserved motifs found in a large number of proteins binding ATP or GTP, and shows a significant similarity to that of homologous proteins from sorghum, grape, and black cottonwood. Moreover, it is also similar (23–30% similarity) to those of various NB-containing R proteins (Figure 4A). We then assessed the sequence diversity of the selected homologs, by generating a phylogenetic tree using the NB sequences (Figure 4B)The NB domains from 10 amino acids N-terminal to the first Gly in the Kinase 1a motif to 10 amino acids beyond the kinase 3amotif were used for analysis.Intriguingly, RLS1 was more closely related to the CC-NB-LRR proteins, Rx, I2, R3a (Moffett et al., 2002<ref name="ref3" />; Couch et al., 2006<ref name="ref4" />; Jia et al., 2010<ref name="ref5" />)than to TIR-NB-LRR proteins, N, RRS1-R, CHS3 (Deslandes et al., 2002<ref name="ref6" />; Konagaya et al., 2004<ref name="ref7" />; Yang et al., 2010<ref name="ref8" />).<ref name="ref1" />[[File:RLS1.5A.png|none|300px]][[File:RLS1.5B.png|none|300px]]    (figure4) <ref name="ref1" />
-.The RLS1 locus was roughly mapped on chromosome 2. Subsequent finingmapping delimited the RLS1 locus to a 60-kb region between markers M17 and M24 (Figure 4A
+.The RLS1 locus was roughly mapped on chromosome 2. Subsequent finingmapping delimited the RLS1 locus to a 60-kb region between markers M17 and M24 (Figure 5A
-and 4B). DNA sequencing analysis of the entire region in the rls1 mutant revealed a single C-to-T nucleotide substitution in the second exon of LOC_Os02g10900 (MSU Rice Genome Annotation Project: http://rice.plantbiology.msu.edu/), which results in Ser-to-Phe change at 994 residue (Figure 4C).<ref name="ref1" />[[File:RLS1.4.png|none|300px]]     (figure4)<ref name="ref1" />
+and 5B). DNA sequencing analysis of the entire region in the rls1 mutant revealed a single C-to-T nucleotide substitution in the second exon of LOC_Os02g10900 (MSU Rice Genome Annotation Project: http://rice.plantbiology.msu.edu/), which results in Ser-to-Phe change at 994 residue (Figure 4C).<ref name="ref1" />[[File:RLS1.4.png|none|300px]]     (figure5)<ref name="ref1" />
 ==Labs working on this gene==