Os02g0244100 - Revision history

192.168.72.52 at 06:31, 14 May 2015

2015-05-14T06:31:51Z

Fcgbean: /* Function */

2014-06-01T14:00:57Z

‎Function

Fcgbean: /* Function */

2014-06-01T13:59:12Z

‎Function

Fcgbean: /* Annotated Information */

2014-06-01T13:58:10Z

‎Annotated Information

Fcgbean: /* References */

2014-06-01T13:56:35Z

‎References

Fcgbean: /* References */

2014-06-01T13:56:22Z

‎References

Fcgbean: /* References */

2014-06-01T13:55:39Z

‎References

Fcgbean: /* References */

2014-06-01T13:55:18Z

‎References

Fcgbean: /* References */

2014-06-01T13:47:30Z

‎References

Fcgbean: /* References */

2014-06-01T13:47:14Z

‎References

← Older revision		Revision as of 06:31, 14 May 2015
Line 64:		Line 64:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0244100\|~~
−	~~Description = Zinc finger, RING-type domain containing protein\|~~
−	~~Version = NM_001052949.1 GI:115445268 GeneID:4328856\|~~
−	~~Length = 6429 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0244100, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:8144222..8150650\|~~
−	~~CDS = 8144506..8144706,8145995..8146046,8146132..8146177,8146270..8146351,8146430..8146592<br>,8146685..8146787,8148484..8148550,8149829..8150386\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:8144222..8150650~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:8144222..8150650~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggggaacaggataggggggaggaggaaggcgggggtggaggagaggtacacgaggccgcaggggctgtacgagcacagggacatcgaccagaagaagctccggaagctgatcctcgaggccaagctcgcgccgtgctacatgggcgccgacgacgccgccgccgccgccgacctcgaggagtgccccatctgcttcctgtactacccaagtcttaaccgatcaaagtgttgctcaaaagggatatgcaccgagtgctttctccaaatgaaaccaactcacactgctcagcctacacaatgtccattctgcaaaactcccagttatgctgtggagtatcgtggtgtaaagacaaaggaggaaaggagcatagaacaatttgaagagcagaaagtcatagaagcacaaatgaggatgcgccagcaagcacttcaagatgaagaagataagatgaaaagaaaacagaacaggtgctcttctagcagaacaatcacaccgaccaaagaagtggagtatagagatatttgcagcacatccttttcagtgccgtcataccgatgtgctgagcaagaaactgaatgctgttcatcggaaccttcatgctctgcccagactagcatgcgccctttccattctaggcataaccgtgatgataacattgacatgaatatagaggatatgatggttatggaagcgatttggcgttccattcagggaagtatagggaatcctgtctgtggcaactttatgcctgtaactgagccatctccgcgtgaacgccagccattcgttccagctgcttctctagaaatacctcatggtggtggattttcctgtgcggttgcggcaatggctgagcaccagccacccagtatggacttctcttacatggctggcagcagcgcattcccagttttcgacatgttccggcgaccatgcaacattgctggtggaagcatgtgtaatctggagagctcaccggagagctggagcgggatagcaccaagctgcagcagggaagtggtaagagaagaaggagagtgctcggctgaccactggtcggagggtgcagaggccggaacaagctacgcgggctcagacatcgtggcagatgccgggaccatgccgcagctgcctttcgccgagaacttcgccatggcgccaagccacttccgcccggagagcatcgaagaacagatgatgttttccatggctctttctttagcagatggtcatggaagaacacactcgcaagggttggcatggttgtag</cdnaseq>\|
−	AA = <aaseq>MGNRIGGRRKAGVEERYTRPQGLYEHRDIDQKKLRKLILEAKLA PCYMGADDAAAAADLEECPICFLYYPSLNRSKCCSKGICTECFLQMKPTHTAQPTQCP FCKTPSYAVEYRGVKTKEERSIEQFEEQKVIEAQMRMRQQALQDEEDKMKRKQNRCSS SRTITPTKEVEYRDICSTSFSVPSYRCAEQETECCSSEPSCSAQTSMRPFHSRHNRDD NIDMNIEDMMVMEAIWRSIQGSIGNPVCGNFMPVTEPSPRERQPFVPAASLEIPHGGG FSCAVAAMAEHQPPSMDFSYMAGSSAFPVFDMFRRPCNIAGGSMCNLESSPESWSGIA PSCSREVVREEGECSADHWSEGAEAGTSYAGSDIVADAGTMPQLPFAENFAMAPSHFR PESIEEQMMFSMALSLADGHGRTHSQGLAWL</aaseq>\|
−	DNA = <dnaseqindica>285..485#1774..1825#1911..1956#2049..2130#2209..2371#2464..2566#4263..4329#5608..6165#gcagcagagaggtctccacttccctttcctcccaccccgagaaagccaaaaaaagaaaaattatttttcaaaaaaaaagctcgcctcgccctcgcgtcgtcgtccccatcaccccccctcctccgctccgagtacgcgtgcgtataccaccacctccatctccaccaccgtatgtatctacggtgaggcggcggcggcggaggaggaggaggagggggagtggtgagggtttcatctgcggaggaggagggaggaggagggaggagggtagatctgggagggggatggggaacaggataggggggaggaggaaggcgggggtggaggagaggtacacgaggccgcaggggctgtacgagcacagggacatcgaccagaagaagctccggaagctgatcctcgaggccaagctcgcgccgtgctacatgggcgccgacgacgccgccgccgccgccgacctcgaggagtgccccatctgcttcctggtataaaaccgcctccggggagatgtggcgggtggacgggaggaagagatctctcccctcttcctcacttcctcctcccgcttccttccacttcagctttttctctctttttttttggtgggattttgtcgtaatgctactactagtacttgttgttgcgagagtagggcgtggattgcgtgtggccgggtggtggcgtggagcgtttcgattagggggttgattacttttgctcctgttcgattgtggagagtgccggtggtgtgtggccgttatggagatggatgaccacgcgcagtgttttggggcaagaatttcagtcgacattggcacggttttggggttgtttgtattgttcttggataattagtgcggttcgtggagctgattttgcgaaatgtagtagtagtgtttgaattatttctggtagttagtagtggtatcatacttcgtatgtacattgtccgcaatgttctcctaaattgttttgttttcttaatcatagtttacttacttttattatgtaattctgagatacgtttttttgggataattatagtctaggaggttttgggtactcatttattattgtcaatattctataggcctatctattggctgcctggctgtgatgcattgcatgaaatttaatgtttactgccactcccggggttgggacattacagaccttataggaaatttgactagtttcataaatgaataattggccaactgttctgcaatgttgggtgccttcaatttctaatagtggatgctctatagagtacggaggtaccatggtgatatttgtttgttgtgtgtaatactttatttttggtgtattaatgctcttgggaaccgagattgagaatctattgtagtgaacttgattctgttagctgtgccagagtattttcgatgtctcttgtcaagcctgcatttatttggcacaaagtagattttttaaaaaaaaattctgcagctttaatgctactagcttactgcaattaatgttattactatataggaattttaatgcaattctatatggttgcaattttattgcaattctgcttcattagatctttagctcaaaatcactcaataaatttggttttagatgaaatcatgaaacttgtattataggagtatattatatttggtgttgaattatatgtttgcatttgtgctaatagtggtatttaacaattatcacttctggtatttctgagttcaaactgtttgacaaccactcctgtcctgaaatgcatgttttctttctttgtagtactacccaagtcttaaccgatcaaagtgttgctcaaaagggatatgcaccggtaatacatctatcctataactaacaattgtgttttacttgttaggaccatatacccttatattcaatggttggtttttttgcagagtgctttctccaaatgaaaccaactcacactgctcagcctacacagtatcctttgtgtcacccttgattatattttgtaaccttggcagttggcaatctatattcctttttatgaaaaaaatacttaaccaataaagatgtccattctgcaaaactcccagttatgctgtggagtatcgtggtgtaaagacaaaggaggaaaggagcatagaacaatttgtaagtaatttatattctgatgttttttttttgttttgccaaatgcatttcatttatctcacataatatgtgttacaggaagagcagaaagtcatagaagcacaaatgaggatgcgccagcaagcacttcaagatgaagaagataagatgaaaagaaaacagaacaggtgctcttctagcagaacaatcacaccgaccaaagaagtggagtatagagatatttgcagcacatccttttcaggtctgcacaggctgcaactaacatagaaatttagtaatgtaccatttcttctgcttgatgtggtaatttactatgtgttatgtctgtttcagtgccgtcataccgatgtgctgagcaagaaactgaatgctgttcatcggaaccttcatgctctgcccagactagcatgcgccctttccattctaggcataaccggtatgttattatctttttctctgagttttagggtgtcattgtagcctggttatgttgaactgcaaaccttactacacttctatgttaaataccctacctcaaccatgttgaagggaagcaaatgagaagtattgttaaaataggataaaggaaagtaacagtattatctatagaatcaaatcgataacaaagatcaaccgttggattaaattggatagtggggaccagacaccataaaacactggcatttcggacaagatcatttaattattccactttaagcttgtgcagtctgtcctgatccactgcactatttaagtggatgagaagctgtgattggagttactgttctagtgttaaggttgacttgtatcagatacaattgcctatccagtgacaaagtttgaatgtttaatttgtgaaagtgtgaatggagagaatttctgcccacatcattgttgtaccatgatagttacagtaatctttagtttatctatactctagagggataaaaacaccaaaacagtttgatcaaaattgttcgaggtaaatcctaagtataaaattgagaatggatttgtttttcaatatggttatttgttatcgacattcagtgtttttatttcacacaatggccaattccgaaaaaacaatctgggttctttttatcccactgtccataccaagttgatgtagcaagtaactactacacaaaatagtatattgtagccctttacatgcatccaatagattaagtggtcttcaatccaaggatgaaataagcaataacgtaggttccgataccaaattagcacaaaacaatgctaaatgcttttagaggaagtaaaccactcatttggttcttttacctataaacttgtgttcgcttgatgttctcaatattgtcaggctattttatagacttgaggagtaaacatttcttgatgacgttatcttctcctattgtgctagacataaaatacagtgtagcataacttgtgtactgtgagtttttttcaagtttttcttgatgctgcacaatagtatacaacaatcgtctattcagtcacacatggcacatcctcacatcaaacagaagttactttttatgatgttaatgtgtagtataacagcagaagctaaacggtagagggatacaggatactcgagtcaatatgaagttggggttccatggagtatttgaatcgaataaaacatcttgatgatcaatattggttttcatattgtttctataagctagtttcatatttttctagagaacctattattattttgcttcctgtcctcctcagaagattgacattctgtactggtagtgaatttgtgtttccctcataccctgtttgggagggtttcaacgtcagcttagtgcagtgctgcaaagtttaaactctatgaccagagcataagtatggcttaaggacttctgatgacaaagccatttttgaaacctgaagcctattttgatcaacttatgaacttatatggaaaaccagtttctgaaagaggccaaatatcaataaatggtgccttaatctcccttcagttttatagtttaccatatggatatttttcctgtactaagtgtttcttgcttgctggtcatgataatcctttatgctgttgagatgaaaatggtttctaaaattatgaaactgtgtgtttccccttacagtgatgataacattgacatgaatatagaggatatgatggttatggaagcgatttggcgttccattcaggttagtagttttctcactggtccttacatgagattattgataatatgcatatggcatactgtggataatattataaaagctgatttgttgggtcaggtaatggtttgtaaatgagctgcacaaaaatagattgttatttgcattgaacatgaaagtttgctaatctcctggcatgcttgttgaattcagagcattttgcgagttctgataaatgcaagatctagtctgcacaagcagaacctgtattgttaagtgttcaataataaaaaaaaatgtcaattaaattgttgagaagtgtattggcgatagtggataatgtaggatatgtttggtttgagggaccaacatcagttagttcatcattgcctcattcctcaggcacatgctagtggaaaaatgagtaatgcagtattcatgccaaaatcatcctagatggtgtgattcctcaaacaaaacaggccagtagatgatggggttggtaagataagttatctttttgtcattttacttgagcagtactgcgcttggcacaaaaatatttctggtcattttgtgagaacaagaggacttttcacattcctgcattcctgaagggaacttattatctaacagcattgctaaactcagctcttcccatgcccttagccatcaaattgatttgttatgatggttgcattgttagttttgcggtcccaattattagccacttaacgttcaggtcaggaactaatggtgttttttttctccgtcctttgtgttatactacctccatcctaaaataagtgcagccatgagtttccgcgcccaactttgatcgtccgttttatttgaaatttttttataattagcatttttgttgttataagatgataaaacatgaatagtactttactcgtgacttatgtttttgattttttcaaaaaaatttcaaataagacgaatggtcaaagttgggcgctgaaaaccatggctgcacttattttgggacggaggtagtatcatttattcatttgctgttcaagctgtagctcatcgtgtactgttccccaataagttgcttgccatttggtctatgtttccagcttctttcttttgtgagcatttttccttctgtatagcttgttactagaaagatgtaaactttatgttaaatgctgcttcatctttgaatttagattcttgggaataaacaataagcaaagttcatgtattgcgtatagaaaagtctgcatatatttctatcctaatacggtcaatcttttctctgagcaggagcagggaagtatagggaatcctgtctgtggcaactttatgcctgtaactgagccatctccgcgtgaacgccagccattcgttccagctgcttctctagaaatacctcatggtggtggattttcctgtgcggttgcggcaatggctgagcaccagccacccagtatggacttctcttacatggctggcagcagcgcattcccagttttcgacatgttccggcgaccatgcaacattgctggtggaagcatgtgtaatctggagagctcaccggagagctggagcgggatagcaccaagctgcagcagggaagtggtaagagaagaaggagagtgctcggctgaccactggtcggagggtgcagaggccggaacaagctacgcgggctcagacatcgtggcagatgccgggaccatgccgcagctgcctttcgccgagaacttcgccatggcgccaagccacttccgcccggagagcatcgaagaacagatgatgttttccatggctctttctttagcagatggtcatggaagaacacactcgcaagggttggcatggttgtaggtagagcactctaattttgacgccttgctgccctctcccttgcgctgctgttgctgcccttctctcccctgcctcctgcttctgcctcctttttgccaccagctcttggcctttttgttcaccccttttttgcatgtgttttgtcgtcatggtttgatatagatccagctatagctctccattgttattgcttatatgtatgtaaaatggaatatgaggaaatagaaaaaaggaaaatgggtcaacagttcttttggcagtagg</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052949.1 RefSeq:Os02g0244100]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 11: / Line 11: @@
 indirectly influencing milk filling rate, endosperm cell size, endosperm size and, ultimately, grain size
 (width, weight and yield) (from reference<ref name="ref1" />).'']]
-This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops(<ref name="ref1" />).
+This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops.
 Reduced expression of GW2 increases grain size (mainly grain width), resulting in enhanced grain weight, whereas overexpression
-decreases grain size and weight. The naturally occurring WY3 allele of GW2, which encodes a truncated version of the protein with a 310–amino
+decreases grain size and weight(from reference<ref name="ref1" />).
 acid deletion, increases the number of cells of the spikelet hull, resulting in a wider spikelet hull, and subsequently
 accelerates the grain milk filling rate, resulting in increased grain width, weight and yield.
@@ Line 27: / Line 29: @@
 thereby recruiting an E2 and targeting HY5 and other substrates for ubiquitination and degradation by the proteasome40. In addition, the
 WY3 variant of GW2 has an intact RING domain, thereby retaining E3 ubiquitin ligase activity, but is truncated by 310 amino acids that
-might contain the substrate-binding domain. The absence of a substrate-binding domain suggests that WY3 GW2 is a null allele(<ref name="ref1" />).
+might contain the substrate-binding domain. The absence of a substrate-binding domain suggests that WY3 GW2 is a null allele.
 The coincidence of the GW2 null allele and the increased number of cells in the spikelet hull suggest that WY3 GW2 protein does not
 interact with the substrate(s) involved in cell division and does not target them for ubiquitination and subsequent degradation. These
 data suggest that GW2 E3 ligase is a new negative regulator of cell division, targeting its substrate(s) to proteasomes for regulated proteolysis. We examined GW2 for the presence of other known domains
 but did not find any known domains in GW2. Identification and characterization of both the substrate-binding domain of GW2 and
-the GW2 target substrate will be challenging but worth pursuing(<ref name="ref1" />).
+the GW2 target substrate will be challenging but worth pursuing(from reference<ref name="ref1" />).
 ===Expression===

@@ Line 11: / Line 11: @@
 indirectly influencing milk filling rate, endosperm cell size, endosperm size and, ultimately, grain size
 (width, weight and yield) (from reference<ref name="ref1" />).'']]
-This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops(from reference<ref name="ref1" />).
+This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops(<ref name="ref1" />).
 Reduced expression of GW2 increases grain size (mainly grain width), resulting in enhanced grain weight, whereas overexpression
 decreases grain size and weight. The naturally occurring WY3 allele of GW2, which encodes a truncated version of the protein with a 310–amino
@@ Line 27: / Line 27: @@
 thereby recruiting an E2 and targeting HY5 and other substrates for ubiquitination and degradation by the proteasome40. In addition, the
 WY3 variant of GW2 has an intact RING domain, thereby retaining E3 ubiquitin ligase activity, but is truncated by 310 amino acids that
-might contain the substrate-binding domain. The absence of a substrate-binding domain suggests that WY3 GW2 is a null allele(from reference<ref name="ref1" />).
+might contain the substrate-binding domain. The absence of a substrate-binding domain suggests that WY3 GW2 is a null allele(<ref name="ref1" />).
 The coincidence of the GW2 null allele and the increased number of cells in the spikelet hull suggest that WY3 GW2 protein does not
 interact with the substrate(s) involved in cell division and does not target them for ubiquitination and subsequent degradation. These
 data suggest that GW2 E3 ligase is a new negative regulator of cell division, targeting its substrate(s) to proteasomes for regulated proteolysis. We examined GW2 for the presence of other known domains
 but did not find any known domains in GW2. Identification and characterization of both the substrate-binding domain of GW2 and
-the GW2 target substrate will be challenging but worth pursuing(from reference<ref name="ref1" />).
+the GW2 target substrate will be challenging but worth pursuing(<ref name="ref1" />).
 ===Expression===

@@ Line 11: / Line 11: @@
 indirectly influencing milk filling rate, endosperm cell size, endosperm size and, ultimately, grain size
 (width, weight and yield) (from reference<ref name="ref1" />).'']]
-This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops.
+This gene is reported as GW2, a new QTL that controls rice grain width and weight. GW2 encodes a previously unknown RING-type protein with E3 ubiquitin ligase activity, which is known to function in the degradation by the ubiquitin-proteasome pathway. Loss of GW2 function increased cell numbers, resulting in a larger (wider) spikelet hull, and it accelerated the grain milk filling rate, resulting in enhanced grain width, weight and yield. GW2 negatively regulates cell division by targeting its substrate(s) to proteasomes for regulated proteolysis. The functional characterization of GW2 provides insight into the mechanism of seed development and is a potential tool for improving grain yield in crops(from reference<ref name="ref1" />).
 Reduced expression of GW2 increases grain size (mainly grain width), resulting in enhanced grain weight, whereas overexpression
 decreases grain size and weight. The naturally occurring WY3 allele of GW2, which encodes a truncated version of the protein with a 310–amino
@@ Line 27: / Line 27: @@
 thereby recruiting an E2 and targeting HY5 and other substrates for ubiquitination and degradation by the proteasome40. In addition, the
 WY3 variant of GW2 has an intact RING domain, thereby retaining E3 ubiquitin ligase activity, but is truncated by 310 amino acids that
-might contain the substrate-binding domain. The absence of a substrate-binding domain suggests that WY3 GW2 is a null allele.
+might contain the substrate-binding domain. The absence of a substrate-binding domain suggests that WY3 GW2 is a null allele(from reference<ref name="ref1" />).
 The coincidence of the GW2 null allele and the increased number of cells in the spikelet hull suggest that WY3 GW2 protein does not
 interact with the substrate(s) involved in cell division and does not target them for ubiquitination and subsequent degradation. These
 data suggest that GW2 E3 ligase is a new negative regulator of cell division, targeting its substrate(s) to proteasomes for regulated proteolysis. We examined GW2 for the presence of other known domains
 but did not find any known domains in GW2. Identification and characterization of both the substrate-binding domain of GW2 and
-the GW2 target substrate will be challenging but worth pursuing.
+the GW2 target substrate will be challenging but worth pursuing(from reference<ref name="ref1" />).
 ===Expression===

@@ Line 57: / Line 57: @@
 ==References==
 <references>
-<ref name="ref1">Song, X. J., Huang, W., Shi, M., Zhu, M. Z., & Lin, H. X. (2007). A QTL for rice grain width and weight encodes a previously unknown RING-type E3 ubiquitin ligase. Nature genetics, 39(5), 623-630.</ref1>
+<ref name="ref1">Song, X. J., Huang, W., Shi, M., Zhu, M. Z., & Lin, H. X. (2007). A QTL for rice grain width and weight encodes a previously unknown RING-type E3 ubiquitin ligase. Nature genetics, 39(5), 623-630.</ref>
 <ref name="ref2">Li, Q., Li, L., Yang, X., Warburton, M.L., Bai, G., Dai, J., Li, J., and Yan, J. (2010). Relationship, evolutionary fate and function of two maize co-orthologs of rice GW2 associated with kernel size and weight. BMC Plant Biol 10, 143.</ref>
 </references>

@@ Line 61: / Line 61: @@
 </references>
-<ref name="ref">
 .Li, Q., Li, L., Yang, X., Warburton, M.L., Bai, G., Dai, J., Li, J., and Yan, J. (2010). Relationship, evolutionary fate and function of two maize co-orthologs of rice GW2 associated with kernel size and weight. BMC Plant Biol 10, 143.</ref>
 </references>