Os02g0324400 - Revision history

192.168.72.52 at 06:34, 14 May 2015

2015-05-14T06:34:52Z

Zhuping at 14:34, 7 June 2014

2014-06-07T14:34:08Z

Zhuping at 14:26, 7 June 2014

2014-06-07T14:26:14Z

Zhuping at 13:56, 7 June 2014

2014-06-07T13:56:41Z

Zhuping at 13:37, 7 June 2014

2014-06-07T13:37:10Z

Zhuping at 13:25, 7 June 2014

2014-06-07T13:25:16Z

Zhuping at 13:19, 7 June 2014

2014-06-07T13:19:59Z

Zhuping at 12:54, 7 June 2014

2014-06-07T12:54:54Z

124.16.129.48 at 19:14, 22 July 2012

2012-07-22T19:14:04Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os02g0324400| Description = Conserved hypothetical protein| Version = NM_001053232.1 GI:115445834 GeneID:4329179| Length = 1038 bp| Definition ..."

2012-06-25T02:27:27Z

Created page with "{{JaponicaGene| GeneName = Os02g0324400| Description = Conserved hypothetical protein| Version = NM_001053232.1 GI:115445834 GeneID:4329179| Length = 1038 bp| Definition ..."

New page

{{JaponicaGene|
GeneName = Os02g0324400|
Description = Conserved hypothetical protein|
Version = NM_001053232.1 GI:115445834 GeneID:4329179|
Length = 1038 bp|
Definition = Oryza sativa Japonica Group Os02g0324400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:13043483..13044520|
CDS = 13043866..13044261|
GCID = <gbrowseImage1>
name=NC_008395:13043483..13044520
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:13043483..13044520
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattga</cdnaseq>|
AA = <aaseq>MSRRLGAAAAVLLLWLAVLTFALHGYYGGRLGSARRRNILLQHP ALALHLPTRKMLLAVASFDDASSPSSLTTTDRHHHHHRHHGHHHHRGHDRWNRKGVPP TAAGPGEEVDPRFGVQKRLVPTGPNPLHH</aaseq>|
DNA = <dnaseqindica>384..779#ggctcggcgcgcgcgcgcgcgcggcgcgggtggtttacgcaagctgagctgccgccgcgcggcttgctagttagcgtcaaatcgatcggttcgagccctgcaataggagtcccacgcaagcaactccttcctcctcttaaccacgccctctctcaccgtcgtcttcctcaattccctctacccctcaccgcccgcacgcgcgcgctgcctagctaacacaaaccgccattgcttcccctcctcctccttgccgccgtgcttagcttgctgtttgtagcttgttggctagagaggtcgtcgtacgccggtggctggcgatcgccggccggccggtggtccatgactaacggtgccgcgagctgccagcctgcagcgcggtggacatgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattgatgccggcggctcgccattgatgggtgctcgagtttttctgcggtgagtcacgcgcacatatacactactacaccgttcttgttgtgttcatcgatcgaccaaaggctagctagctagctagcacagtaatattgattccaattccaacctgtggatgaattcaagaaagcattgccgatgtgtgtgtgctcttgcatgtatgtaccacgatcatatcagaaagcttcaaaacaagaggagaaaaagaaatgttactagc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053232.1 RefSeq:Os02g0324400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

← Older revision		Revision as of 06:34, 14 May 2015
Line 19:		Line 19:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0324400\|~~
−	~~Description = Conserved hypothetical protein\|~~
−	~~Version = NM_001053232.1 GI:115445834 GeneID:4329179\|~~
−	~~Length = 1038 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0324400, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:13043483..13044520\|~~
−	~~CDS = 13043866..13044261\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:13043483..13044520~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:13043483..13044520~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattga</cdnaseq>\|
−	AA = <aaseq>MSRRLGAAAAVLLLWLAVLTFALHGYYGGRLGSARRRNILLQHP ALALHLPTRKMLLAVASFDDASSPSSLTTTDRHHHHHRHHGHHHHRGHDRWNRKGVPP TAAGPGEEVDPRFGVQKRLVPTGPNPLHH</aaseq>\|
−	DNA = <dnaseqindica>384..779#ggctcggcgcgcgcgcgcgcgcggcgcgggtggtttacgcaagctgagctgccgccgcgcggcttgctagttagcgtcaaatcgatcggttcgagccctgcaataggagtcccacgcaagcaactccttcctcctcttaaccacgccctctctcaccgtcgtcttcctcaattccctctacccctcaccgcccgcacgcgcgcgctgcctagctaacacaaaccgccattgcttcccctcctcctccttgccgccgtgcttagcttgctgtttgtagcttgttggctagagaggtcgtcgtacgccggtggctggcgatcgccggccggccggtggtccatgactaacggtgccgcgagctgccagcctgcagcgcggtggacatgagccggcgactcggcgccgcggccgccgtcctcctcctgtggctcgccgtgctcaccttcgccttgcacggctactacggcggccgcctcggctccgcgaggcggcggaatatcctcctccaacacccggcgctagcgctccatctccccaccaggaagatgctcctcgccgtggcgagcttcgacgacgcctcctcgccgtcgtcgttgacgaccaccgatcgtcatcatcaccatcacaggcatcatggccaccaccatcatcgcggccatgatcggtggaacaggaagggtgtcccgccgacggcagctgggccgggcgaggaggtcgacccgcggttcggcgtgcagaagaggctggtcccgacgggccccaaccccctgcaccattgatgccggcggctcgccattgatgggtgctcgagtttttctgcggtgagtcacgcgcacatatacactactacaccgttcttgttgtgttcatcgatcgaccaaaggctagctagctagctagcacagtaatattgattccaattccaacctgtggatgaattcaagaaagcattgccgatgtgtgtgtgctcttgcatgtatgtaccacgatcatatcagaaagcttcaaaacaagaggagaaaaagaaatgttactagc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053232.1 RefSeq:Os02g0324400]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 4: / Line 4: @@
 ===Function===
 Our previous study demonstrated that FON2 is a negative regulator of stem cell maintenance in the FM [8]. In this study, introduction of indica FOS1 into fon2-1 by genetic methods using a chromosomal segment substitution line or by Agrobacteriummediated transformation completely suppressed the fon2 mutation. This finding suggests that FOS1 can substitute for the function ofFON2. Thus, FOS1 is likely to play an important role in maintenance of the FM in indica and either one of FOS1 and FON2 appears to be sufficient to restrict stem cell proliferation in the FM.
 ===Expression===

@@ Line 4: / Line 4: @@
 ===Function===
 Our previous study demonstrated that FON2 is a negative regulator of stem cell maintenance in the FM [8]. In this study, introduction of indica FOS1 into fon2-1 by genetic methods using a chromosomal segment substitution line or by Agrobacteriummediated transformation completely suppressed the fon2 mutation. This finding suggests that FOS1 can substitute for the function ofFON2. Thus, FOS1 is likely to play an important role in maintenance of the FM in indica and either one of FOS1 and FON2 appears to be sufficient to restrict stem cell proliferation in the FM.
 ===Expression===

← Older revision		Revision as of 13:56, 7 June 2014
Line 10:		Line 10:

	===Molecular Characterization===		===Molecular Characterization===
−	Sequence analysis revealed that FOS1 consists of one exon with a single open reading frame and encodes a putative small protein of 131 amino acids (Figure S1). FOS1 has a signal peptide that is rich in hydrophobic amino acids at its N-terminus and a CLE domain at its C-terminus (Figure 3A). Among the CLE proteins in	+	Sequence analysis revealed that FOS1 consists of one exon with a single open reading frame and encodes a putative small protein of 131 amino acids (Figure S1). FOS1 has a signal peptide that is rich in hydrophobic amino acids at its N-terminus and a CLE domain at its C-terminus (Figure 4A). Among the CLE proteins in rice and Arabidopsis, the CLE domain of FOS1 is more similar to those of CLE8 and CLE13 than to those of FON2, FCP1 and CLV3 (Figure 4B).
−	rice and Arabidopsis, the CLE domain of FOS1 is more similar to those of CLE8 and CLE13 than to those of FON2, FCP1 and CLV3 (Figure 3B).

@@ Line 1: / Line 1: @@
 The FON2 SPARE1 (FOS1) gene encoding a CLE protein functions along with FON2 in maintenance of in the floral meristem(FM).
 ==Annotated Information==
 ===Function===
 Our previous study demonstrated that FON2 is a negative regulator of stem cell maintenance in the FM [8]. In this study, introduction of indica FOS1 into fon2-1 by genetic methods using a chromosomal segment substitution line or by Agrobacteriummediated transformation completely suppressed the fon2 mutation. This finding suggests that FOS1 can substitute for the function ofFON2. Thus, FOS1 is likely to play an important role in maintenance of the FM in indica and either one of FOS1 and FON2 appears to be sufficient to restrict stem cell proliferation in the FM.
 ===Expression===
 FOS1 encodes a secreted protein with a CLE domain, and is expressed in the SAM, IMand FM. Genetic and molecular analyses indicate that FOS1, together with FON2, is likely to be involved in stem cell maintenance in the FM, in rice species in the Oryza genus.
-===Evolution===
 ===Molecular Characterization===
+Sequence analysis revealed that FOS1 consists of one exon with a single open reading frame and encodes a putative small protein of 131 amino acids (Figure S1). FOS1 has a signal peptide that is rich in hydrophobic amino acids at its N-terminus and a CLE domain at its C-terminus (Figure 3A). Among the CLE proteins in
 ==Labs working on this gene==
-Please input related labs here.
+Department of Biological Sciences, Graduate School of Science, University of Tokyo, Bunkyo-ku, Tokyo, Japan.
 ==References==
-Please input cited references here.
+<ref name="ref1"> Takuya Suzaki;Masako Ohneda;Taiyo Toriba;Akiko Yoshida;Hiro-Yuki Hirano FON2 SPARE1 Redundantly Regulates Floral Meristem Maintenance with FLORAL ORGAN NUMBER2 in Rice PLoS Genetics, 2009, 5(10): 1-9</ref>
 ==Structured Information==

@@ Line 8: / Line 8: @@
 Please input evolution information here.
-You can also add sub-section(s) at will.
+===Molecular Characterization===
 ==Labs working on this gene==

← Older revision		Revision as of 19:14, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os02g0324400\|		GeneName = Os02g0324400\|