Os02g0543000 - Revision history

Caojiabao: /* Phenotypic analysis */

2017-06-02T02:44:58Z

‎Phenotypic analysis

Caojiabao: /* Phenotypic analysis */

2017-06-02T02:44:45Z

‎Phenotypic analysis

Caojiabao at 02:43, 2 June 2017

2017-06-02T02:43:21Z

Caojiabao at 02:37, 2 June 2017

2017-06-02T02:37:53Z

Liming Pan at 16:13, 18 October 2016

2016-10-18T16:13:39Z

192.168.72.52 at 06:38, 14 May 2015

2015-05-14T06:38:56Z

124.16.129.48 at 19:16, 22 July 2012

2012-07-22T19:16:41Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os02g0543000| Description = ABA/WDS induced protein family protein| Version = NM_001053606.2 GI:297599386 GeneID:4329601| Length = 807 bp| Defi..."

2012-06-25T02:34:12Z

Created page with "{{JaponicaGene| GeneName = Os02g0543000| Description = ABA/WDS induced protein family protein| Version = NM_001053606.2 GI:297599386 GeneID:4329601| Length = 807 bp| Defi..."

New page

{{JaponicaGene|
GeneName = Os02g0543000|
Description = ABA/WDS induced protein family protein|
Version = NM_001053606.2 GI:297599386 GeneID:4329601|
Length = 807 bp|
Definition = Oryza sativa Japonica Group Os02g0543000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:21023532..21024338|
CDS = 21023712..21023788,21023850..21023889,21024108..21024266|
GCID = <gbrowseImage1>
name=NC_008395:21023532..21024338
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:21023532..21024338
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctgaggagaagaagcaccaccacctgttccaccacaagaaggacggggaggaggagagctccggcgtggtggactacgacaaggagaagaagcaccacaagcacctcgagcagctcggcggcctcggcgccatcgccgccggcgcctacgctctccacgagaagcaccaggcgaagaaggacacggagaacgcgccttccacgagcaccacgagaagaaggacgccaagaagcacgccgccgaccaatactagatcgatcccgatcgaatga</cdnaseq>|
AA = <aaseq>MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLEQLGGLG AIAAGAYALHEKHQAKKDTENAPSTSTTRRRTPRSTPPTNTRSIPIE</aaseq>|
DNA = <dnaseqindica>551..627#450..489#73..231#acagatcaacaccggcaaccgactaactctgtctgaaggaagctaagattattaatcagtgagtagctagccatggctgaggagaagaagcaccaccacctgttccaccacaagaaggacggggaggaggagagctccggcgtggtggactacgacaaggagaagaagcaccacaagcacctcgagcagctcggcggcctcggcgccatcgccgccggcgcctacgctctcgtaagtcattaattagtacatttgaccaccactattacaagaaaatcgattttcgcagacgtatatgtcatcccccactttaactaacctatatgttttagccgcttggaaaaatcgattatgtagtggtgaactatgatctaatgataactacctagccatagctgattaattaagagataattaacggagaatttatttgtggtacgtcgttgcagcacgagaagcaccaggcgaagaaggacacggagaacgcgcacgggcacaaggtgaaggaggaggtggcggcggtggccgcgctgggcgccgcggggttcgccttccacgagcaccacgagaagaaggacgccaagaagcacgccgccgaccaatactagatcgatcccgatcgaatgaacgcaagaacgaacggtttatatgcttaattactttctccccataattacatgtatgcatgtggttgatggcttaatttgcttcttcttgttcgtcgtcatacgtcgtcgcttttacttcgtgttcatgtacattaattctgtatccgcactgagtattaaataagtgcgtttgtgctgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053606.2 RefSeq:Os02g0543000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

@@ Line 8: / Line 8: @@
 ===Phenotypic analysis===
-*Plants with artiﬁcial microRNA silencing ofASR5 present a non-transformed phenotype in response to Al because of the induction of '''''ASR1'''''.
+*Plants with artiﬁcial microRNA silencing of ASR5 present a non-transformed phenotype in response to Al because of the induction of '''''ASR1'''''.
 *'''''ASR1''''' has the same sub-cellular localization as ASR5, binds to ASR5 cis-regulatory el-ements, regulates ASR5 regulated genes in a non-preferentialmanner and might replace ASR5 under certain conditions.

@@ Line 9: / Line 9: @@
 ===Phenotypic analysis===
 *Plants with artiﬁcial microRNA silencing ofASR5 present a non-transformed phenotype in response to Al because of the induction of '''''ASR1'''''.
-*''''''ASR1''''' has the same sub-cellular localization as ASR5, binds to ASR5 cis-regulatory el-ements, regulates ASR5 regulated genes in a non-preferentialmanner and might replace ASR5 under certain conditions.
+*'''''ASR1''''' has the same sub-cellular localization as ASR5, binds to ASR5 cis-regulatory el-ements, regulates ASR5 regulated genes in a non-preferentialmanner and might replace ASR5 under certain conditions.
 You can also add sub-section(s) at will.

@@ Line 5: / Line 5: @@
 *'''''Os02g0543000''''' '''''<=>''''' '''''ASR1'''''
 ===Function===
-*'''''ASR1''''' and '''''ASR5''''' act in concert andcomplementarily to regulate gene expression in response to Al.
+*'''''ASR1''''' act in concert andcomplementarily to regulate gene expression in response to Al.
 ===Phenotypic analysis===

@@ Line 1: / Line 1: @@
-The rice '''''Os02g0543000''''' was reported as '''''OsASR3''''' in 2013 <ref name="ref1" /> by researchers from Korea.
+The rice '''''Os02g0543000''''' was reported as '''''ASR1''''' in 2016 <ref name="ref1" /> by researchers from Brazil and USA.
 ==Annotated Information==
 ===Gene Symbol===
-*'''''Os02g0543000''''' '''''<=>''''' '''''OsASR3,ASR3'''''
+*'''''Os02g0543000''''' '''''<=>''''' '''''ASR1'''''
 ===Function===
-* The overexpression of either '''''OsASR1''''' or '''''OsASR3''''' in transgenic rice plants increased their tolerance to drought and cold stress.
+*'''''ASR1''''' and '''''ASR5''''' act in concert andcomplementarily to regulate gene expression in response to Al.
-* The transcriptional control of different rice ASR genes exhibit different tissue-dependent sugar and hormone-sensitivities.
-===Expression===
+===Phenotypic analysis===
-* Coexpression analysis of '''''OsASR1''''' and '''''OsASR3''''' and a comparison of the cis-acting elements upstream of '''''OsASR1''''' and '''''OsASR3''''' suggested that their expression is regulated in common by abiotic stresses but differently regulated by hormone and sugar signals.
+*Plants with artiﬁcial microRNA silencing ofASR5 present a non-transformed phenotype in response to Al because of the induction of '''''ASR1'''''.
-* '''''OsASR1''''' and '''''OsASR3''''' expression was significantly induced by sucrose and sucrose/glucose treatments, respectively
+*''''''ASR1''''' has the same sub-cellular localization as ASR5, binds to ASR5 cis-regulatory el-ements, regulates ASR5 regulated genes in a non-preferentialmanner and might replace ASR5 under certain conditions.
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-* Division of Bioscience and Bioinformatics, Myongji University, 2 Genomics Genetics Institute, GreenGene BioTech, Inc., Yongin 449-728, Korea
+* Programa de Pós-Graduação em Genética e Biologia Molecular – Departamento de Genética, Universidade Federal do Rio Grandedo Sul, Porto Alegre, Brazil
+*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, Porto Alegre, Brazil
 ==References==
 <references>
 * <ref name="ref1">
-Joo J, Lee YH, Kim YK, Nahm BH, Song SI. Abiotic stress responsive rice ASR1
+Arenhart RA, Schunemann M, Bucker Neto L, Margis R, Wang ZY, Margis-Pinheiro M. Rice ASR1 and ASR5 are complementary transcription factors regulating aluminium responsive genes. Plant Cell Environ. 2016 Mar;39(3):645-51. doi:10.1111/pce.12655. Epub 2015 Dec 14. PubMed PMID: 26476017.
 </ref>
 </references>

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os02g0543000''''' was reported as '''''OsASR3''''' in 2013 <ref name="ref1" /> by researchers from Korea.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+* The overexpression of either '''''OsASR1''''' or '''''OsASR3''''' in transgenic rice plants increased their tolerance to drought and cold stress.
+* The transcriptional control of different rice ASR genes exhibit different tissue-dependent sugar and hormone-sensitivities.
 ===Expression===
-Please input expression information here.
+* Coexpression analysis of '''''OsASR1''''' and '''''OsASR3''''' and a comparison of the cis-acting elements upstream of '''''OsASR1''''' and '''''OsASR3''''' suggested that their expression is regulated in common by abiotic stresses but differently regulated by hormone and sugar signals.
+* '''''OsASR1''''' and '''''OsASR3''''' expression was significantly induced by sucrose and sucrose/glucose treatments, respectively
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* Division of Bioscience and Bioinformatics, Myongji University, 2 Genomics Genetics Institute, GreenGene BioTech, Inc., Yongin 449-728, Korea
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

← Older revision		Revision as of 06:38, 14 May 2015
Line 20:		Line 20:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0543000\|~~
−	~~Description = ABA/WDS induced protein family protein\|~~
−	~~Version = NM_001053606.2 GI:297599386 GeneID:4329601\|~~
−	~~Length = 807 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0543000, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:21023532..21024338\|~~
−	~~CDS = 21023712..21023788,21023850..21023889,21024108..21024266\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:21023532..21024338~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:21023532..21024338~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggctgaggagaagaagcaccaccacctgttccaccacaagaaggacggggaggaggagagctccggcgtggtggactacgacaaggagaagaagcaccacaagcacctcgagcagctcggcggcctcggcgccatcgccgccggcgcctacgctctccacgagaagcaccaggcgaagaaggacacggagaacgcgccttccacgagcaccacgagaagaaggacgccaagaagcacgccgccgaccaatactagatcgatcccgatcgaatga</cdnaseq>\|
−	~~AA = <aaseq>MAEEKKHHHLFHHKKDGEEESSGVVDYDKEKKHHKHLEQLGGLG AIAAGAYALHEKHQAKKDTENAPSTSTTRRRTPRSTPPTNTRSIPIE</aaseq>\|~~
−	DNA = <dnaseqindica>551..627#450..489#73..231#acagatcaacaccggcaaccgactaactctgtctgaaggaagctaagattattaatcagtgagtagctagccatggctgaggagaagaagcaccaccacctgttccaccacaagaaggacggggaggaggagagctccggcgtggtggactacgacaaggagaagaagcaccacaagcacctcgagcagctcggcggcctcggcgccatcgccgccggcgcctacgctctcgtaagtcattaattagtacatttgaccaccactattacaagaaaatcgattttcgcagacgtatatgtcatcccccactttaactaacctatatgttttagccgcttggaaaaatcgattatgtagtggtgaactatgatctaatgataactacctagccatagctgattaattaagagataattaacggagaatttatttgtggtacgtcgttgcagcacgagaagcaccaggcgaagaaggacacggagaacgcgcacgggcacaaggtgaaggaggaggtggcggcggtggccgcgctgggcgccgcggggttcgccttccacgagcaccacgagaagaaggacgccaagaagcacgccgccgaccaatactagatcgatcccgatcgaatgaacgcaagaacgaacggtttatatgcttaattactttctccccataattacatgtatgcatgtggttgatggcttaatttgcttcttcttgttcgtcgtcatacgtcgtcgcttttacttcgtgttcatgtacattaattctgtatccgcactgagtattaaataagtgcgtttgtgctgc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053606.2 RefSeq:Os02g0543000]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

← Older revision		Revision as of 19:16, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os02g0543000\|		GeneName = Os02g0543000\|