Os02g0624300 - Revision history

192.168.72.52 at 06:43, 14 May 2015

2015-05-14T06:43:25Z

Shahaishachen: /* Evolution */

2014-06-10T09:59:23Z

‎Evolution

Shahaishachen: /* References */

2014-06-10T07:09:27Z

‎References

Shahaishachen: /* Labs working on this gene */

2014-06-10T07:06:22Z

‎Labs working on this gene

Shahaishachen: /* Function */

2014-06-10T07:03:36Z

‎Function

Shahaishachen: /* Evolution */

2014-06-10T06:57:36Z

‎Evolution

Shahaishachen: /* Annotated Information */

2014-06-10T06:51:46Z

‎Annotated Information

Shahaishachen: /* Evolution */

2014-06-10T06:41:43Z

‎Evolution

Shahaishachen: /* Evolution */

2014-06-10T06:40:05Z

‎Evolution

Shahaishachen: /* Expression */

2014-06-10T06:34:31Z

‎Expression

← Older revision		Revision as of 06:43, 14 May 2015
Line 31:		Line 31:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0624300\|~~
−	~~Description = Similar to Y19 protein\|~~
−	~~Version = NM_001054009.1 GI:115447388 GeneID:4330027\|~~
−	~~Length = 1156 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0624300, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:25765638..25766793\|~~
−	~~CDS = 25765777..25766290,25766409..25766671\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:25765638..25766793~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:25765638..25766793~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccgatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaa</cdnaseq>\|
−	AA = <aaseq>MGRAPCCEKMGLKRGPWTAEEDRILVAHIERHGHSNWRALPRQA GLLRCGKSCRLRWINYLRPDIKRGNFTREEEDAIIHLHDLLGNRWSAIAARLPGRTDN EIKNVWHTHLKKRLEPKPSSGREAAAPKRKATKKAAAVAVAIDVPTTVPVSPEQSLST TTTSAATTEEYSYSMASSADHNTTDSFTSEEEFQIDDSFWSETLAMTVDSTDSGMEMS GGDPLGAGGASPSSSNDDDMDDFWLKLFIQAGGMQNLPQI</aaseq>\|
−	DNA = <dnaseqindica>504..1017#123..385#gcatcacacagacgacgcagcatcagcaacacacacacacaccgagcaatcaatccatcacacacaaacacaaacaaacgcacagggcgcgagagctcgaacgagaggaggaaaggtcggcaatggggagggcgccgtgctgcgagaagatggggctgaagagggggccgtggacggcggaggaggacaggatcctggtggcgcacatcgagcggcacgggcacagcaactggcgcgcgctgccgaggcaggccggccttctccgctgcggcaagagctgccgcctccggtggatcaactacctccgccccgacatcaagcgcggcaacttcacccgcgaggaggaggacgccatcatccacctccacgaccttctcggcaaccggtacttttcaagccactgtccaatactagtttactaatcttttgccttggatacgcgaaagattttgtctcggatttgtttattggttaattaactcgatttgtggcgaatgattcagatggtccgcgattgcagcgaggctgccggggaggacggacaacgagatcaagaatgtgtggcacactcacctcaagaagcggctggagccgaagccgtcgtccggccgggaagccgccgcgcccaagcgaaaggcgaccaagaaggctgcggcggtggcggtggcgatcgacgttccgaccaccgtgccggtgtcgccggagcagtcgctctcgaccacgacgacgtcggccgccaccaccgaggagtactcgtactcgatggcctcctccgcggatcacaacaccacggacagtttcacctcggaggaggagttccagatcgacgacagcttctggtcggagacgctggcaatgacggtggacagcaccgactccgggatggagatgagcggcggcgatcctctcggcgcgggcggtgcctcgccgtcgtcgagcaacgacgacgacatggacgacttctggctcaagctgttcatccaggccggtggcatgcagaatttgccccagatttaatttaggcagagaattggcctcttgggtcgatctcttgttcatttttcttaccaccactattctttgaatctttggagctgtgtaaatctttacaaagcggagagattgatgggaaacgaaagaaggcaatattatcttt</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054009.1 RefSeq:Os02g0624300]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 14: / Line 14: @@
 ===Evolution===
-The phylogenetic tree was constructed by neighbor-joining method (Saitou and Nei 1987) based on the R3 domain amino acid sequence.The  reliability  of  the  tree  was  measured  by  bootstrap  analysis  with  1000  replicates  (Felsenstein  1985).  Numbers  indicated similarity.The  amino  acid  sequences  were  obtained  from  NCBI  with  the  accession  numbers  as  below:  Arabidopsis  thaliana  MYBL2 (AEE35154),  AtETC1  (AEE27280),  AtTRY  (AED96321),  AtCPC  (AEC10691),  AtTCL1  (AEC08388),  AtMYB60  (AEE28351),  AtMYB2 (BAB62130), AtMYB15 (AEE76740); Oryza sativa OsMYB2 (BAA23338), OsMYB4 (Q7XBH4); Catharanthus roseus CrMYB (ABL63124);
+[[File:q.jpg]]The phylogenetic tree was constructed by neighbor-joining method (Saitou and Nei 1987) based on the R3 domain amino acid sequence.The  reliability  of  the  tree  was  measured  by  bootstrap  analysis  with  1000  replicates  (Felsenstein  1985).  Numbers  indicated similarity.The  amino  acid  sequences  were  obtained  from  NCBI  with  the  accession  numbers  as  below:  Arabidopsis  thaliana  MYBL2 (AEE35154),  AtETC1  (AEE27280),  AtTRY  (AED96321),  AtCPC  (AEC10691),  AtTCL1  (AEC08388),  AtMYB60  (AEE28351),  AtMYB2 (BAB62130), AtMYB15 (AEE76740); Oryza sativa OsMYB2 (BAA23338), OsMYB4 (Q7XBH4); Catharanthus roseus CrMYB (ABL63124);
 Glycine max GmMYB176 (ABH02865), Rosa hybrid cultivar RhMYB (ABU53684), Oryza sativa Japonica Group OsMYBS2(AAN63153), OsMYBS3 (AAN63154); Malus xiaojinensis MxMYB1 (AAO45179); Solanum tuberosum StMYB1R-1 (Q2V9B0).

@@ Line 26: / Line 26: @@
 ==References==
-Please input cited references here.
+Balok  CA,  Hilaire  RS  (2002)  Drought  responses  among  seven southwestern  landscape  tree  taxa.  J  Am  Soc  Hortic  Sci  127: 211–218.
 ==Structured Information==

@@ Line 18: / Line 18: @@
 ==Labs working on this gene==
-Please input related labs here.
+College of Life Science, Shandong Normal University, Shandong, P.R. China
 ==References==

@@ Line 6: / Line 6: @@
 The MYB superfamily is one of the largest plant families (Stracke et al. 2001). MYB proteins are characterized by a conserved  MYB  DNA-binding  domain,  which  generally includes 1 to 3 imperfect repeats of 50–53 amino acids in the N-terminal region. Based on the number of adjacent repeats  in  the  binding  domain,  plant  MYB  proteins  are divided into 3 major groups: R1R2R3-MYB, R2R3-MYB, and R1-MYB (Kranz et al. 2000).  e functions of MYB proteins in plants are very diverse. Some plant MYB genes are  involved  in  the  regulation  of  secondary  metabolism, cellular  morphogenesis,  and  cell  cycle  (Ma  et  al.  2009), while others play important roles in the signal transduction responding to plant growth regulators, pathogen infection,and  drought  (Martin  and  Paz  1997;  Dai  et  al.  2007).
 Given the size of the gene family and their roles in plant speci c  processes,  the  MYB  family  is  considered  to  be particularly important in the transcriptional regulation of plants (Jin and Martin 1999; Shuichi et al. 2011).Arizona ash is a member of the family Oleaceae, which is one of the most important trees in the world. Since Arizona ash is characterized by its ability to tolerate drought and salt conditions, it is widely planted in many areas (Balok and Hilaire  2002).In  Arizona  ash,  few  MYB  genes  have  been studied in detail due to its huge and complex genome.The molecular mechanisms of salt tolerance in Arizona ash are not yet clear.
 ===Expression===

← Older revision		Revision as of 06:41, 10 June 2014
Line 11:		Line 11:

	===Evolution===		===Evolution===
		+	[[File:]]

	==Labs working on this gene==		==Labs working on this gene==

← Older revision		Revision as of 06:40, 10 June 2014
Line 11:		Line 11:

	===Evolution===		===Evolution===
−	~~Please input evolution information here.~~
−
−	~~You can also add sub-section(s) at will.~~

	==Labs working on this gene==		==Labs working on this gene==