Os02g0674800 - Revision history

Xysj1981 at 05:42, 8 March 2017

2017-03-08T05:42:24Z

Xysj1981: /* Function */

2017-03-08T05:41:22Z

‎Function

Xysj1981 at 05:40, 8 March 2017

2017-03-08T05:40:54Z

192.168.72.52 at 06:46, 14 May 2015

2015-05-14T06:46:01Z

Siatchenqing: /* Function */

2014-05-30T17:02:30Z

‎Function

Siatchenqing: /* Function */

2014-05-30T16:59:54Z

‎Function

Siatchenqing: /* References */

2014-05-30T16:59:10Z

‎References

Siatchenqing: /* References */

2014-05-30T16:58:51Z

‎References

Siatchenqing: /* References */

2014-05-30T16:58:36Z

‎References

Siatchenqing: /* References */

2014-05-30T16:57:18Z

‎References

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.. However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />.
+The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />.
 ===Expression===
-'''Roc5'''’s closest homolog is maize OCL1, with 85.1% amino acid identity. Roc5 overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells (Fig. 3, B, Q, R, U, and V). In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 (Fig. 6, B, P, S, and T).
+* '''''Roc5''''' overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells. In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 .
 ===Evolution===
-Please input evolution information here.
+* '''''Roc5'''''s closest homolog is maize OCL1, with 85.1% amino acid identity.
 You can also add sub-section(s) at will.

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.. However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />..[[File:Fig.1.jpg|200px|thumb|right|Fig.1 ''oul1'' has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
+The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.. However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />.
-]]
 ===Expression===
 '''Roc5'''’s closest homolog is maize OCL1, with 85.1% amino acid identity. Roc5 overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells (Fig. 3, B, Q, R, U, and V). In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 (Fig. 6, B, P, S, and T).

@@ Line 4: / Line 4: @@
 ===Function===
 The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.. However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />..[[File:Fig.1.jpg|200px|thumb|right|Fig.1 ''oul1'' has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
-]] [[File:654321.jpg|200px|thumb|left|Fig.2 ''Roc5'' characterization and nuclear localization of Roc5 in onion epidermal cells. C to H, 35S::Roc5-GFP (C–E) and 35S::GFP (F–H) constructs were transiently expressed in onion epidermal cells, showing bright-field (C and F), GFP (D and G), and merged (E and H) signals.]] [[File:12345.jpg|200px|thumb|left|Fig.3 Enhanced or suppressed expression of Roc5 leads to adaxially or abaxially rolled leaves, respectively. A, qRT-PCR analysis of Roc5 expression shows that the two independent overexpression lines (ox1 and ox2) had higher expression levels than the wild type (wt), whereas cosuppression(cs1 and cs2) transcripts were lower than the wild type, with the expression of cs2 near the oul1 level. B, Morphological phenotypes of wildtype, oul1, ox1, ox2, cs1, and cs2 plants show that the leaves of overexpression lines were adaxially rolled and cosuppression lines were abaxially rolled, whereas those of the wild type were flat. ab, Abaxial; ad, adaxial. Bars = 10 cm (top) and 5 mm (middle and bottom). C to N, Toluidine blue O-stained adaxial epidermal peels abutting large (C–H) or small (I–N) veins of the wild type (C and I) and oul1, ox1, ox2, cs1, and cs2 (D–H and J–N) showing purple-stained bulliform cells. O to T, Cross sections of leaves show that, compared with the wild type (O), bulliform cells in ox1 (Q) and ox2 (R) were smaller, whereas those in cs1 (S) and cs2 (T) plants were larger, with cs2 (T) similar to oul1 (P). Red lines highlight the bulliform cells. Bars = 20 mm (C–T). U and V, Measurement of numbers (U) and area (V) of bulliform cells in the wild type, ox1, ox2, cs1, and cs2. Data show means of biological replicates with SD (n>30).]]
+]]
 ===Expression===
 '''Roc5'''’s closest homolog is maize OCL1, with 85.1% amino acid identity. Roc5 overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells (Fig. 3, B, Q, R, U, and V). In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 (Fig. 6, B, P, S, and T).

← Older revision		Revision as of 06:46, 14 May 2015
Line 27:		Line 27:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0674800\|~~
−	~~Description = Similar to OCL1 homeobox protein\|~~
−	~~Version = NM_001054253.1 GI:115447876 GeneID:4330297\|~~
−	~~Length = 7048 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0674800, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:28374727..28381774\|~~
−	~~CDS = 28375293..28375646,28376807..28377180,28377409..28377586,28379246..28379473,28379583..28379684<br>,28379783..28380499,28380638..28380755,28380868..28381112,28381222..28381320<br>\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:28374727..28381774~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:28374727..28381774~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgagctttgggggcctctttgacggcggcggcgggggaggcatgcagttccctttcgccagtggcttcgcgtcctcgccggcgctctccctcgcgctggacaacgccggcggtggcatcggcgggcggatgctcggcggcggcgctggcgctggttctagcgcgggcggcgcgatgacgagggacactgaggcggagaacgacagccggtcgggaagcgaccatctcgacgccatctcggccgccggcgaggacgacgtcgaggacgccgagcccagcaactcccgcaagaggaagaagcgataccaccgccacacgccgcagcagatccaagagctcgaagcgctgttcaaggagtgcccccatccggacgagaagcagcgcgccgagctcagcaggaggctctccctcgatgcgcggcaggtcaagttctggttccagaatcgccgcacgcagatgaagacgcaactggagcggcacgagaacgcgcttctcaagcaggagaacgacaagctgcgcgccgagaacatgacgatccgggaggcgatgcgcagcccaatgtgcggcagctgcgggagccccgccatgctcggggaggtgtccctagaggagcagcacctgcgcatcgagaatgcgcgcctcaaggacgagctcaaccgcgtgtgcgccctcgccaccaagttcctaggcaagcccatctccctcctgtcgccgccgcccttgctgcagccgcacctctcgctgcctatgcctaactcgtcgctggagctagcgatcggaggcatcggtggcttagggtctctcggtacactacccggctgtatgaatgagttcgccggaggcgtgtcgagcccgatgggcacggtgatcacgcctgcgcgcgcaaccggggctgctataccatcgctggtgggtaacatcgacaggtccgtgttcttagagcttgcaatcagcgcgatggacgaacttgtcaagatggcacagatggacgatccattgtgggttccggcactgcctggttctcccagcaaggaggtgctcaactttgaggagtatcttcactccttcctaccgtgcattggcatgaagcctgccggctacgtctctgaggcctcgagggaatccggtctagtcatcatcgacaacagccttgcccttgtagagaccctcatggatgagagacggtggtctgacatgttctcgtgcatgattgctaaggcaacagtgcttgaggaggtgtctaccggcattgcaggaagcagaaatggcgcgttgctgctgatgaaggctgagctacaggtgctctcacctctagtaccaattagggaggttacatttctccggttttgtaagcagctggctgagggtgcatgggcagtagttgatgtgtccattgatggtttagtgagagatcataattctggaacggcacccacaggtggaaatgtgaagtgtaggagggtaccttccggctgtgtgatgcaagacactcccaatgggtattgcaaggtcacatgggttgagcatacggaatacgatgaggcatcagtgcaccagctctaccgtccactccttcggtctggtctcgcctttggcgccaggcgttggcttgcgacgctgcagcgccaatgcgaatgccttgccatcctcatgtcctctgctacagtgacagcaaatgactcgactgctatatcgcaagagggcaagcgaagcatgctgaagctggcacgccggatgacggagaacttctgtgctggggtgagcgcatcgtctgcacgtgaatggagcaagctggatggtgcgaccggtagcatcggggaggacgtgcgcgtgatggcacggaagagcgtgagcgagcctggagagccaccgggcgtggtgctgagcgcggccacctcggtgtgggtgcccgtggctccggagaagctcttcaacttcctgcgcgatgagcagctgcgtgcggagtgggacatcctcagcaatggaggccccatgcaggagatgacccagatcgccaaggggcagcgggatgggaactcggtttcactcctcagggccagtgctgtgagtgccaaccagagcagcatgctgatacttcaggagacgtgcaccgacgcttctggctccattgttgtgtacgctccggtagacatcccggcaatgcagcttgtcatgaatggtggcgactccacctatgttgctctgcttccatccggattcgccatcctgcccgatgggcctcgcatcggcgccaccgggtacgagacgggcggctctctgctcaccgtggcgttccagattcttgtcaacaaccagcccaccgccaagctcaccgtggaatcggtcgagaccgtgaacaatctcatctcctgcaccatcaagaagatcaagacggcgctgcagtgcgacgcctga</cdnaseq>\|
−	AA = <aaseq>MSFGGLFDGGGGGGMQFPFASGFASSPALSLALDNAGGGIGGRM LGGGAGAGSSAGGAMTRDTEAENDSRSGSDHLDAISAAGEDDVEDAEPSNSRKRKKRY HRHTPQQIQELEALFKECPHPDEKQRAELSRRLSLDARQVKFWFQNRRTQMKTQLERH ENALLKQENDKLRAENMTIREAMRSPMCGSCGSPAMLGEVSLEEQHLRIENARLKDEL NRVCALATKFLGKPISLLSPPPLLQPHLSLPMPNSSLELAIGGIGGLGSLGTLPGCMN EFAGGVSSPMGTVITPARATGAAIPSLVGNIDRSVFLELAISAMDELVKMAQMDDPLW VPALPGSPSKEVLNFEEYLHSFLPCIGMKPAGYVSEASRESGLVIIDNSLALVETLMD ERRWSDMFSCMIAKATVLEEVSTGIAGSRNGALLLMKAELQVLSPLVPIREVTFLRFC KQLAEGAWAVVDVSIDGLVRDHNSGTAPTGGNVKCRRVPSGCVMQDTPNGYCKVTWVE HTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCECLAILMSSATVTANDSTAISQ EGKRSMLKLARRMTENFCAGVSASSAREWSKLDGATGSIGEDVRVMARKSVSEPGEPP GVVLSAATSVWVPVAPEKLFNFLRDEQLRAEWDILSNGGPMQEMTQIAKGQRDGNSVS LLRASAVSANQSSMLILQETCTDASGSIVVYAPVDIPAMQLVMNGGDSTYVALLPSGF AILPDGPRIGATGYETGGSLLTVAFQILVNNQPTAKLTVESVETVNNLISCTIKKIKT ALQCDA</aaseq>\|
−	DNA = <dnaseqindica>6129..6482#4595..4968#4189..4366#2302..2529#2091..2192#1276..1992#1020..1137#663..907#455..553#ctggttctatttttctctcgcgtccacacgacgggggggcctcctctcctctccctcctcccctcgtctccacactagacttgccattttgaccctccgcttgctccctcctcccgttcctatctccccgccgccgtacataagtgctttctttaatcggatgcgtcccctcccctcgccaccagttcgttcgctcgctcgctcgctcgctcgccttgttaatctatccctccctctctcccgcccctccgtccgccgtggagggttagggttttgagggttcgctcgcctcggcgaggctttatctctctaccagtagtctcttactcttcttcgttgggccgtgggttaggaatcgggttgtgaggcgtgtgggaggggcggggtagatccaaggaagaggactttctcgagtttacgccgtggtgttttgcttcggcgaggaggcggcggcatgagctttgggggcctctttgacggcggcggcgggggaggcatgcagttccctttcgccagtggcttcgcgtcctcgccggcgctctccctcgcgctggtatgcgttcggcggctgtcgcggaccggggttgcgtcagctgttcgtagacacgagagttttctcctcgatcgagaggttattgattgattctctattttgttgacaggacaacgccggcggtggcatcggcgggcggatgctcggcggcggcgctggcgctggttctagcgcgggcggcgcgatgacgagggacactgaggcggagaacgacagccggtcgggaagcgaccatctcgacgccatctcggccgccggcgaggacgacgtcgaggacgccgagcccagcaactcccgcaagaggaagaagcgataccaccgccacacgccgcagcagatccaagagctcgaagcgtaaagcaaattcccctctcaacgctcgctcgtactttgcatccttctcctctgtgccaacctttttctctttgtcctctcatgcatggatcgatgcgtccgtcttgtgtaggctgttcaaggagtgcccccatccggacgagaagcagcgcgccgagctcagcaggaggctctccctcgatgcgcggcaggtcaagttctggttccagaatcgccgcacgcagatgaaggtaaatcatccgcgagaacatcgcatcgtgtgccttagtcttcttctctcgtcggcgttcgagccggttcgtttcgtgcaatttcctgacacggtttcatgatccccccgcgcgcgccgcgatcttcgttttaccaagacgcaactggagcggcacgagaacgcgcttctcaagcaggagaacgacaagctgcgcgccgagaacatgacgatccgggaggcgatgcgcagcccaatgtgcggcagctgcgggagccccgccatgctcggggaggtgtccctagaggagcagcacctgcgcatcgagaatgcgcgcctcaaggacgagctcaaccgcgtgtgcgccctcgccaccaagttcctaggcaagcccatctccctcctgtcgccgccgcccttgctgcagccgcacctctcgctgcctatgcctaactcgtcgctggagctagcgatcggaggcatcggtggcttagggtctctcggtacactacccggctgtatgaatgagttcgccggaggcgtgtcgagcccgatgggcacggtgatcacgcctgcgcgcgcaaccggggctgctataccatcgctggtgggtaacatcgacaggtccgtgttcttagagcttgcaatcagcgcgatggacgaacttgtcaagatggcacagatggacgatccattgtgggttccggcactgcctggttctcccagcaaggaggtgctcaactttgaggagtatcttcactccttcctaccgtgcattggcatgaagcctgccggctacgtctctgaggcctcgagggaatccggtctagtcatcatcgacaacagccttgcccttgtagagaccctcatggatgaggtttgggctaatgtcctccacatttcgcaccgtatacttatgttccgttccaatcctataatgtactaatgttggtgttacttgcattcatttcacagagacggtggtctgacatgttctcgtgcatgattgctaaggcaacagtgcttgaggaggtgtctaccggcattgcaggaagcagaaatggcgcgttgctgctggtgagtgctgatcaacagtgctaatgttcatttatcttacatagtgtaagacgtagctaacatattttctttctgaattgttaatttttcttgtgtttgcttgcaacagatgaaggctgagctacaggtgctctcacctctagtaccaattagggaggttacatttctccggttttgtaagcagctggctgagggtgcatgggcagtagttgatgtgtccattgatggtttagtgagagatcataattctggaacggcacccacaggtggaaatgtgaagtgtaggagggtaccttccggctgtgtgatgcaagacactcccaatgggtattgcaaggtaacaactaacaagaagccatttaaatggtttctctgttctctcacaataatggttcactatgattaatgtggcagtaagtcagttaatagtattgtcatcttgtagttctgaacaggtttgctggattttttttattttttattttgaaagggactgctttttattttttattttgaaagggactgctggattttttacatcgaagtaactggtcaaagtttaccccggcgttttagagctatgttaattccactacttctccactaccactatcactatgcactgctcagaacttggggatgacgtttgtttaagagtgtgtgattagtttaatggtgcgatttgctgatgcccatgcagcatagtgttcacaagtcaaggcctaataggttaattagggttatgagcccactacccaaaataaacaattcgtttggtcaacgaggagatggagtatacaatttatttagaataattaagtgtttttgtggatccaacactgttccccaaacatgttttcttttgcttgtttattcttagctccaactttcctaggggattagatgcttctaccccttggatggtgcaccttgggtaacttcttgtccgcaatttaatcaatatgtcccttacatgttgaaatctggaccacttgctcctatttggttgaaaaattggtctctatgtccttgggttttcacaattcttaatttgatctcaatctgtggcactaatgaaggaaacattttgtttagaatttctaaggtgaacaaaccaacaacatatccggcatctaatctgtttttaatagatttgaagtaaagagcagttggatgggattagggatttcagtagaaataccacctgatctaggggcttttaggaaacatatttggttctactattcctttgtcaacttaatcacatgctggtttataatatgcacatcatgttggtgagttcattcactttcttgaagagttcagatggagaaataactcttaaactagttggcatgcacgccctaaaaataaaaaaaactagttgcacgcatcattcagaagtttgggtatatcgcatggcaatgaattaacaatgttgcactcttgatcgaaatgattgaaatttgttggctaatccatgtgcacagacatctgctgttgtttctttgtgttatttttttatgttgctcaagatatgaaaatctttcttcagtagttccctcatgtgtactcttttcccgtactgtgcactccttgctttcttgatacattatttcggatgaatccagttcttagtctgtttgcttatgaataacaacagatcaaaatgtctcaacccttaggccagatataaattagtaactaaacaaattatacgctaatgccaagttacttgttggtggtcaacagtataggttcacatctcgaggctggttaacaggcaaaccttgcacattttttacgtttctgcccctacttgaccaacagcaaagaggggaagaaaacttagggtaaaaacaaaaatgtgctctgcactgtgaagccacagtagggtgttgtattgcactgcagagctctcatctgatgtattgcacctaaagacacatgcatgtgggcgtgcatttatgggctaacggatgcatttaccctgtaggtcacatgggttgagcatacggaatacgatgaggcatcagtgcaccagctctaccgtccactccttcggtctggtctcgcctttggcgccaggcgttggcttgcgacgctgcagcgccaatgcgaatgccttgccatcctcatgtcctctgctacagtgacagcaaatgactcgactggtacaggaaattctgaacctctacttgccattttccatctaaaacgagctcaatttgcggaatcaactgtgcgcaaattttgcatggaattcatttcggttgacgtcattcaaacaggacaaactgaaagaatatctccattgttcgagtagaatggccagtgcagttgtaggacagatatcttggcttggaatactgataattacgtgttgcatttgatgcatgcagctatatcgcaagagggcaagcgaagcatgctgaagctggcacgccggatgacggagaacttctgtgctggggtgagcgcatcgtctgcacgtgaatggagcaagctggatggtgcgaccggtagcatcggggaggacgtgcgcgtgatggcacggaagagcgtgagcgagcctggagagccaccgggcgtggtgctgagcgcggccacctcggtgtgggtgcccgtggctccggagaagctcttcaacttcctgcgcgatgagcagctgcgtgcggagtgggacatcctcagcaatggaggccccatgcaggagatgacccagatcgccaaggggcagcgggatgggaactcggtttcactcctcagggccagtgtgagtatttgctaccccaaatctgctctaaacatttcttcttttgtgcggtgcctaactggatagtactactgtatatagtaaaacgtagagtaattttttagcagtacgtgccatcaatttcgaacaaaacagcacagtagataaggctaaccattttcggtggtctcttccgacacaagcctgcacacaagctggtatgctgtatgtattgcattaatcacaagtatgggccaatgtaatgtaggtgtgcgttccatttctaggtgatgggtgggctattaattctaaagttattccaccttattcgtttgttaacttgctataggcctatagtagacgatttaaagttcttggtctgtagtatttattagtagcccttttcttatcttcaacccaaactctacttagcactgcacttaatcacttatatactgatcagtgcattgacaagaagattgctgaaagctaggtagagacattgtgcctaacaaagaaaagtttataagttcccgtagcctaaatgagaggttagcaagttttgtgagacctctactaatgtctttcctttccagaaaaaaaggctactcctgtctaaactatgaacaccgtacccgataaccaatattgtaaactgacgatgacatggagaagatcacaaacaaaaagtctggcaactttccatcagatattgttcggttagagaaaaaagggtcgtaatcaaggcccgactagaacgactagcaccgaactttacacgaggtctgcagaagaggacaaactaggacagaacagggtaggaaacgcagatctgcttgaaaaaggtgtcaggttgacaacttgcactactgtgttgtgtgtgtaccatgcgttagcatgcatccggatcctgtatgcagatcatgattccagggactgcttgacaagaaaaacataggaaaaacaaatcctccaaacactagcatctccggataatgaggctaatgtctgaactgtttatgactggtcagatgttaactagtctcgcgggtacaatgtcactattaaatttcgttctttacccccatgaatccttttctctaattatgttgcttctgtagttcataatattttgcagaaaataaaacaagatattttcttttttaccttttctgatgcaggctgtgagtgccaaccagagcagcatgctgatacttcaggagacgtgcaccgacgcttctggctccattgttgtgtacgctccggtagacatcccggcaatgcagcttgtcatgaatggtggcgactccacctatgttgctctgcttccatccggattcgccatcctgcccgatgggcctcgcatcggcgccaccgggtacgagacgggcggctctctgctcaccgtggcgttccagattcttgtcaacaaccagcccaccgccaagctcaccgtggaatcggtcgagaccgtgaacaatctcatctcctgcaccatcaagaagatcaagacggcgctgcagtgcgacgcctgagtgtttacagtggatttatgtccgcggggatacgccggcggcgacgagcctgagtcaagaacgaaccgcgcgttgaaaaaagaaaataacctttgctaggtgataaggatcttgcttggccggtccttagcacagagcaatggtggtggttcgggtattgactctggcctctaccgtacgccgatctctccccggcagccggtgatcattggatgatacagtaccatgcattttggacatttcttcgaggggttaaacttatgctttagtttcgtcgtcttagggagtcaaacctgtatacttttggcagttggctcatcgttgctctagtgttgtttgttttttgttgtgctatggctgtatgaggtagcctgtactagtagtttctcggaaatgctgggttcatactgtactagtgtcgtccatacttcatataggttatggtacaagtgtaggatcaaattgaaggtttcagaaagtgtatcagccaataatgtctgtttgacagtggcattgctatggatcagctgaaaattgttttttgcaatacacatgggatcaaagct</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054253.1 RefSeq:Os02g0674800]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F). However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H). '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity.[[File:Fig.1.jpg|200px|thumb|right|Fig.1 ''oul1'' has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
+The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.. However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />..[[File:Fig.1.jpg|200px|thumb|right|Fig.1 ''oul1'' has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
 ]] [[File:654321.jpg|200px|thumb|left|Fig.2 ''Roc5'' characterization and nuclear localization of Roc5 in onion epidermal cells. C to H, 35S::Roc5-GFP (C–E) and 35S::GFP (F–H) constructs were transiently expressed in onion epidermal cells, showing bright-field (C and F), GFP (D and G), and merged (E and H) signals.]] [[File:12345.jpg|200px|thumb|left|Fig.3 Enhanced or suppressed expression of Roc5 leads to adaxially or abaxially rolled leaves, respectively. A, qRT-PCR analysis of Roc5 expression shows that the two independent overexpression lines (ox1 and ox2) had higher expression levels than the wild type (wt), whereas cosuppression(cs1 and cs2) transcripts were lower than the wild type, with the expression of cs2 near the oul1 level. B, Morphological phenotypes of wildtype, oul1, ox1, ox2, cs1, and cs2 plants show that the leaves of overexpression lines were adaxially rolled and cosuppression lines were abaxially rolled, whereas those of the wild type were flat. ab, Abaxial; ad, adaxial. Bars = 10 cm (top) and 5 mm (middle and bottom). C to N, Toluidine blue O-stained adaxial epidermal peels abutting large (C–H) or small (I–N) veins of the wild type (C and I) and oul1, ox1, ox2, cs1, and cs2 (D–H and J–N) showing purple-stained bulliform cells. O to T, Cross sections of leaves show that, compared with the wild type (O), bulliform cells in ox1 (Q) and ox2 (R) were smaller, whereas those in cs1 (S) and cs2 (T) plants were larger, with cs2 (T) similar to oul1 (P). Red lines highlight the bulliform cells. Bars = 20 mm (C–T). U and V, Measurement of numbers (U) and area (V) of bulliform cells in the wild type, ox1, ox2, cs1, and cs2. Data show means of biological replicates with SD (n>30).]]

← Older revision		Revision as of 16:59, 30 May 2014
Line 20:		Line 20:

	==References==		==References==
		+	<references>
		+	<ref name="ref1">Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.</ref>
		+	<ref name="ref2">Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507.</ref>
		+	<ref name="ref3">Khaled AS, Vernoud V, Ingram GC, Perez P, Sarda X, Rogowsky PM. Engrailed-ZmOCL1 fusions cause a transient reduction of kernel size in maize. Plant Mol Biol 2005;58:123-39.</ref>
		+	</references>

	==Structured Information==		==Structured Information==

← Older revision		Revision as of 16:58, 30 May 2014
Line 20:		Line 20:

	==References==		==References==
−	~~<references>~~
−
−	~~</references>~~

	==Structured Information==		==Structured Information==

@@ Line 21: / Line 21: @@
 ==References==
 <references>
-<ref name="ref1">Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.</ref>
 </references>

@@ Line 22: / Line 22: @@
 <references>
 <ref name="ref1">Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.</ref>
-<ref name="ref2"> Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507.</ref>
+<ref name="ref2">Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507.</ref>
 <ref name="ref3">Khaled AS, Vernoud V, Ingram GC, Perez P, Sarda X, Rogowsky PM. Engrailed-ZmOCL1 fusions cause a transient reduction of kernel size in maize. Plant Mol Biol 2005;58:123-39.</ref>
 </references>
 ==Structured Information==
 {{JaponicaGene|