Os02g0765600 - Revision history

Chenxi Sang at 09:31, 9 November 2016

2016-11-09T09:31:42Z

Chenxi Sang at 09:30, 9 November 2016

2016-11-09T09:30:21Z

Chenxi Sang at 09:28, 9 November 2016

2016-11-09T09:28:24Z

Chenxi Sang at 09:28, 9 November 2016

2016-11-09T09:28:03Z

Chenxi Sang at 09:07, 9 November 2016

2016-11-09T09:07:05Z

192.168.72.52 at 06:51, 14 May 2015

2015-05-14T06:51:07Z

Selma: /* Expression */

2014-05-26T14:18:58Z

‎Expression

Selma: /* References */

2014-05-26T14:12:02Z

‎References

Selma: /* Expression */

2014-05-26T14:11:34Z

‎Expression

Selma: /* Annotated Information */

2014-05-26T14:06:28Z

‎Annotated Information

@@ Line 2: / Line 2: @@
 ==Annotated Information==
-[[File:Os02g0765600.png|right|thumb|527px|'''Figure 1.''' ''a-Amylase activity and expression levels of eight a-amylase genes during grain filling.<ref name="ref1" />.'']]
+[[File:Os02g0765600.png|right|thumb|427px|'''Figure 1.''' ''a-Amylase activity and expression levels of eight a-amylase genes during grain filling.<ref name="ref1" />.'']]
 ===Gene Symbol===
 *'''''Os02g0765600''''' '''''<=>''''' '''''OsAmy1A''''','''''Amy1A'''''

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Gene Symbol===
 *'''''Os02g0765600''''' '''''<=>''''' '''''OsAmy1A''''','''''Amy1A'''''
@@ Line 14: / Line 15: @@
 * The intensity of the expression of all a-amylase genes in the course of grain filling clearly indicates that the newly characterized '''''Amy3A''''' gene was expressed at a considerable level under high temperature from 15 DA.
 ==Labs working on this gene==
 * National Agricultural Research Center, Joetsu, Japan

@@ Line 14: / Line 14: @@
 * The intensity of the expression of all a-amylase genes in the course of grain filling clearly indicates that the newly characterized '''''Amy3A''''' gene was expressed at a considerable level under high temperature from 15 DA.
-[[File:Os02g0765600.png|center|thumb|727px|'''Figure 1.''' ''a-Amylase activity and expression levels of eight a-amylase genes during grain filling.<ref name="ref1" />.'']]
+[[File:Os02g0765600.png|center|thumb|527px|'''Figure 1.''' ''a-Amylase activity and expression levels of eight a-amylase genes during grain filling.<ref name="ref1" />.'']]
 ==Labs working on this gene==
 * National Agricultural Research Center, Joetsu, Japan

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os02g0765600''''' was reported as '''''Amy1A''''' in 2012 <ref name="ref1" /> by researchers from Japan.
 ==Annotated Information==
 ===Function===
-Alpha-amylase gene, RAmylA, encodes rice α-amylase isoform A.
+* '''''Amy1A''''' is a member of α-Amylase (EC3.2.1.1) gene family, which encodes a starch-hydrolyzing enzyme.
 ===Expression===
-A significant difference in the seed germinability was observed between the two rice cultivars, 'Nipponbare' and 'Suweon 287', under anoxia (i.e., during germination in submerged soil at 18℃), although little difference was seen under aerobic (in air) or hypoxic (in water) conditions. The number of α-amylase isoforms synthesized in germinating seeds was inversely proportional to the O2 concentrations at the early germination stage. The formation of isoform B was promoted by oxygen supply, while isoform H was undetectable if the seeds were unable to germinate. The activity of isoform H was highly correlated with the coleoptile length in the submerged soil at 18℃, indicating that isoform H is a critical factor for seed germination under anoxia.  The expression of the rice α-amylase RAmy1A gene was repressed when the seeds germinated under hypoxia or anoxia[1]. Northern blot analysis and RNA-PCR were used to detect the expression of α-amylase genes in various tissues. Alpha-amylase mRNA was abundant in germinating seeds and callus. RAmy1A and RAmy3E were expressed in all tissues and RAmy1A transcript was most abundant in the germinating seeds[2]. And RAmy1A was demonstrated to be sugar tepressed in rice embryos and functional dissection of the promoter of RAmy1A in relation of its sugar-modulated expression was performed[3].
+* A series of quantitative real-time RT-PCR analyses using gene-specific primer sets for respective a-amylase genes revealed that the expression of '''''Amy1C''''' and '''''Amy3A''''' as well as '''''Amy1A''''', '''''Amy3D''''' and '''''Amy3E''''' was up-regulated under high temperature (33 °C/28 °C) in the middle of the ripening stage at around 15 days after flowering (DAF; Figure 1b).
+* '''''Amy1A''''' and '''''Amy1C''''' showed a similar pattern of expression in the high temperature plot, gradually increasing from 8 DAF and peaking at 15–20 DAF. '''''Amy3A''''' and '''''Amy3D''''' expression peaked around 15 DAF, while '''''Amy3E''''' showed high levels at 8–30 DAF in the high temperature plot. In contrast, the expression of '''''Amy2A''''', '''''Amy3B''''' and '''''Amy3C''''' was not induced by high temperature (Figure 1b).
-[[File:1-s2.0-S0014579398000672-gr1.jpg]]
+* The intensity of the expression of all a-amylase genes in the course of grain filling clearly indicates that the newly characterized '''''Amy3A''''' gene was expressed at a considerable level under high temperature from 15 DA.
 ==Labs working on this gene==
 * National Agricultural Research Center, Joetsu, Japan
 * RIKEN Plant Science Center, Tsurumi, Yokohama, Japan
 * Niigata University, Ikarashi, Niigata, Japan
 ==References==

@@ Line 18: / Line 18: @@
 ==Labs working on this gene==
-(1) Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo 113-8657, Japan
+* National Agricultural Research Center, Joetsu, Japan
-----
+* RIKEN Plant Science Center, Tsurumi, Yokohama, Japan
-(2) Bioscience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
+* Niigata University, Ikarashi, Niigata, Japan
 ==References==
-. Jirong Huang;Kyoko Toyofuku;Junji Yamaguchi;Shigemi Akita, Expression of α-amylase isoforms and the RAmy1A gene in rice (Oryza sativa L.) during seed germination, and its relationship with coleoptile length in submerged soil, Plant production science, 2000, 3(1): 32-37
+<references>
-----
+* <ref name="ref1">
-.Ning Huang;Nozomu Koizumi;Stephen Reinl;Raymond L. Rodriguez, Structural organization and differential expression of rice α-amylase genes, Nucleic Acids Research, 1990, 18(23): 7007-7014
+Hakata M, Kuroda M, Miyashita T, et al. Suppression of α-amylase genes improves quality of rice grain ripened under high temperature.[J]. Plant Biotechnology Journal, 2012, 10(9):1110–1117.
-----
+</ref>
-.  Akiyoshi Morita;Taka-aki Umemura;Mitsuyo Kuroyanagi;Yuzo Futsuhara;Pierdomenico Perata;Junji Yamaguchi, Functional dissection of a sugar-repressed α-amylase gene (RAmy1A) promoter in rice embryos, FEBS Letters, 1998, 423(1): 81-85
+</references>
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

← Older revision		Revision as of 06:51, 14 May 2015
Line 38:		Line 38:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0765600\|~~
−	~~Description = Alpha-amylase precursor (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) (Isozyme 1B)\|~~
−	~~Version = NM_001054755.1 GI:115448880 GeneID:4330832\|~~
−	~~Length = 1846 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0765600, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:33135190..33137035\|~~
−	~~CDS = 33135415..33135666,33135751..33136562,33136657..33136789,33136898..33137005\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:33135190..33137035~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:33135190..33137035~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctga</cdnaseq>\|
−	AA = <aaseq>MQVLNTMVNKHFLSLSVLIVLLGLSSNLTAGQVLFQGFNWESWK ENGGWYNFLMGKVDDIAAAGITHVWLPPPSHSVGEQGYMPGRLYDLDASKYGNEAQLK SLIEAFHGKGVQVIADIVINHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMICRDDPY GDGTGNPDTGADFAAAPDIDHLNKRVQRELIGWLDWLKMDIGFDAWRLDFAKGYSADM AKIYIDATEPSFAVAEIWTSMANGGDGKPNYDQNAHRQELVNWVDRVGGANSNATAFD FTTKGILNVAVEGELWRLRGEDGKAPGMIGWWPAKATTFVDNHDTGSTQHLWPFPSDK VMQGYAYILTHPGNPCIFYDHFFDWGLKEEIERLVSIRNRQGIHPASELRIMEADSDL YLAEIDGKVITKIGPRYDVEHLIPEGFQVVAHGDGYAIWEKI</aaseq>\|
−	DNA = <dnaseqindica>1370..1621#474..1285#247..379#31..138#aatcatccatctccgaagtgtgtctgcagcatgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtcctccttggcctctcctccaacttgacagccgggcaagtcctgtttcaggtaagagatcgccatgagttgggtttcaggcttcagtgaactgatcgggttttgtactgagcctaagagaatgatgcagtgatgctcttgtgtttgatgatgatgcagggattcaactgggagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatcgccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaaggtgcggtgctctgctctctcgatcccctccgtcgtcgcaccattgccggcaaaatacatgcacaggtcgttgaattgcttgaatgcttctgcaggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcagctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctacggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgaccacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggacatcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaagatctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcgaacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaactgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaagggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaaggcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgacaccggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgcatacatcctcacccaccccggcaacccatgcatcgtgagtagccaactcgatcagaaattctgaatcatcctgcaaactgatcgatgaactgatgataaattctgtaaaattgttcagttctacgaccatttcttcgattggggtctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcgagcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaaggtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccaggtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctgagcgcacgatgacgagactctcagtttagcagatttaacctgcgatttttaccctgaccggtatacgtatatacgtgccggcaacgagctgtatccgatccgaattacggatgcaattgtccacgaagtacttcctccgtaaataaagtgaggatcagggacatacatttgtatggttttacgaataatgctatgcaataaaatttgcactgcttaatgcttatgc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054755.1 RefSeq:Os02g0765600]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 6: / Line 6: @@
 ===Expression===
-A significant difference in the seed germinability was observed between the two rice cultivars, 'Nipponbare' and 'Suweon 287', under anoxia (i.e., during germination in submerged soil at 18℃), although little difference was seen under aerobic (in air) or hypoxic (in water) conditions. The number of α-amylase isoforms synthesized in germinating seeds was inversely proportional to the O2 concentrations at the early germination stage. The formation of isoform B was promoted by oxygen supply, while isoform H was undetectable if the seeds were unable to germinate. The activity of isoform H was highly correlated with the coleoptile length in the submerged soil at 18℃, indicating that isoform H is a critical factor for seed germination under anoxia.  The expression of the rice α-amylase RAmy1A gene was repressed when the seeds germinated under hypoxia or anoxia[1]. Northern blot analysis and RNA-PCR were used to detect the expression of α-amylase genes in various tissues. Alpha-amylase mRNA was abundant in germinating seeds and callus. RAmy1A and RAmy3E were expressed in all tissues and RAmy1A transcript was most abundant in the germinating seeds.
+A significant difference in the seed germinability was observed between the two rice cultivars, 'Nipponbare' and 'Suweon 287', under anoxia (i.e., during germination in submerged soil at 18℃), although little difference was seen under aerobic (in air) or hypoxic (in water) conditions. The number of α-amylase isoforms synthesized in germinating seeds was inversely proportional to the O2 concentrations at the early germination stage. The formation of isoform B was promoted by oxygen supply, while isoform H was undetectable if the seeds were unable to germinate. The activity of isoform H was highly correlated with the coleoptile length in the submerged soil at 18℃, indicating that isoform H is a critical factor for seed germination under anoxia.  The expression of the rice α-amylase RAmy1A gene was repressed when the seeds germinated under hypoxia or anoxia[1]. Northern blot analysis and RNA-PCR were used to detect the expression of α-amylase genes in various tissues. Alpha-amylase mRNA was abundant in germinating seeds and callus. RAmy1A and RAmy3E were expressed in all tissues and RAmy1A transcript was most abundant in the germinating seeds[2]. And RAmy1A was demonstrated to be sugar tepressed in rice embryos and functional dissection of the promoter of RAmy1A in relation of its sugar-modulated expression was performed[3].
 ===Ontology===