Os02g0818000 - Revision history

Zhennan at 02:42, 30 March 2017

2017-03-30T02:42:30Z

Chenxi Sang at 13:12, 28 October 2016

2016-10-28T13:12:40Z

Chenxi Sang at 13:11, 28 October 2016

2016-10-28T13:11:46Z

192.168.72.52 at 06:54, 14 May 2015

2015-05-14T06:54:32Z

Xysj2012: /* Structured Information */

2015-05-14T06:04:27Z

‎Structured Information

Zhangye at 08:57, 1 March 2015

2015-03-01T08:57:30Z

124.16.129.48 at 19:25, 22 July 2012

2012-07-22T19:25:38Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os02g0818000| Description = CBS domain containing protein| Version = NM_001055060.1 GI:115449676 GeneID:4331153| Length = 2152 bp| Definition =..."

2012-06-25T03:01:03Z

Created page with "{{JaponicaGene| GeneName = Os02g0818000| Description = CBS domain containing protein| Version = NM_001055060.1 GI:115449676 GeneID:4331153| Length = 2152 bp| Definition =..."

New page

{{JaponicaGene|
GeneName = Os02g0818000|
Description = CBS domain containing protein|
Version = NM_001055060.1 GI:115449676 GeneID:4331153|
Length = 2152 bp|
Definition = Oryza sativa Japonica Group Os02g0818000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:35978345..35980496|
CDS = 35979184..35979200,35979351..35979522,35979640..35979816,35979925..35979994,35980085..35980156<br>,35980289..35980344|
GCID = <gbrowseImage1>
name=NC_008395:35978345..35980496
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:35978345..35980496
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>aggcctccggctacgatcttccggtgccgggcatcgacgttcatggacgggagcctccggctagagatcgacgagaaccctgaagccatcatctccggtgagtggccggagaacttctccctgctcagctacgacgatctccgcgcctacctccagtcacaggaggccgctgctcaagccgacaaccagcgtgtggcgctcctgagtgaagccatgtcggcgcctgtgctggtagccactgccgagcagacgctggaggaggttgagtgccactttgagacggtctcaggtctcccagttatagatgccagcctcagatgtgttggagtgatcgtcaagagtgaccgggccagggcttctcatgggtcaaagacgaagattgcagaagtgatgacctctccagccatcactctaccatctgacaaaacagtaatggatgcggcagctctgatgctaaagaagaagatccacagattaccaattgtaaatcaggacagacaagtgataggtatagttacccgtgctgacgttcttcgcgagttggaagccctgctggaggtttag</cdnaseq>|
AA = <aaseq>RPPATIFRCRASTFMDGSLRLEIDENPEAIISGEWPENFSLLSY DDLRAYLQSQEAAAQADNQRVALLSEAMSAPVLVATAEQTLEEVECHFETVSGLPVID ASLRCVGVIVKSDRARASHGSKTKIAEVMTSPAITLPSDKTVMDAAALMLKKKIHRLP IVNQDRQVIGIVTRADVLRELEALLEV</aaseq>|
DNA = <dnaseqindica>840..856#1007..1178#1296..1472#1581..1650#1741..1812#1945..2000#cggccaagctcgactgcaagttcagcaagcaacttggcagatgcatacacagcatcgaagcatccaagatcgatcgcccacctaacacggcgagctatctgttttccagcggcgaaagaaaccacgggcacggcgagtcggctcaccggccggccggtcggtactcagtaccaaaccaaaggtcaggatgatccggcttatccactgccacgtgacctgggcccaagagaatcccgccagccaatcgccgcgcgccacgtcgcccgctctgtccctgtagaacacacaatcatgtccgaattccacgtcagtccacatccaaacttggagaaatctgagagaattactcacactaacctgacttcttcactgatgaatgcaacccatcgtacttggtagtagtagtacatatccatataaccatatcctgtttcaggccttgtcagtgacaccttggttaaaaccacccatgcaccattctgctgctctcaaatcactatcctgaatacactaatctcaatctaattactaagtttcagccaaacctcagaatatgcaaaatagtcatcttcagcttgcaatttgcagatccataagttttgccatatgcatggactatgataaatgccacctctgaatctctgatagcagaaacaaatgatgatgagatactaacaagcactaatggagtattaaaaaagatctgagcatggatgaggtcaaagtccaccaataggatctgagcagtagcagtcattggtgggccagcacctcccatgcattcctatccacctcagctccctgacaatagacgcaagtatccagttcactataaatgaaggcctccggctacgatctgcaggagaaaaaacagtcagaagctaaggaagaaaaagtatagacacagtgatacaatggcctgcatcaacacattccagagctgctccgtcctcaagggagcaaagatcaatggtaccaagatcggaggagggaggggatcaccaaccttccggtgccgggcatcgacgttcatggacgggagcctccggctagagatcgacgagaaccctgaagccatcatctccggtgagtggccggagaacttctccctgctcagctacgacgatctccgcgcctacctccagtcacaggaggccgctgctcaagccgacaaccaggtgcactgatcacaccatatatacatagattcttcttcttcagatcaccaactgtcgatcttcttcttaagatcttgctaaactctgaactggttgcatggttggtgaattgaccagcgtgtggcgctcctgagtgaagccatgtcggcgcctgtgctggtagccactgccgagcagacgctggaggaggttgagtgccactttgagacggtctcaggtctcccagttatagatgccagcctcagatgtgttggagtgatcgtcaagagtgaccgggccagggcttctcatggggtcagctctctttctcctctcacacacacatacatgatacatatccctctcactcacgcacatactcaacaacaaaaataagtgctgatctattgcttcttgtaacagtcaaagacgaagattgcagaagtgatgacctctccagccatcactctaccatctgacaaaacagtaatgggtaatccatcgttgttttcgcccttattttttttggttattttccacttagctaccagttaagctaacaaggcatatgcaatgtctacagatgcggcagctctgatgctaaagaagaagatccacagattaccaattgtaaatcaggacagacaagtgataggtgagttttgagcagtggccaatacagaaaaaaaaagggctttcattttttccccttgattttataccatccttaacattgataattcagagtatgttgcatgctaaatggagttccaaacactattaacaggtatagttacccgtgctgacgttcttcgcgagttggaagccctgctggaggtttagacgtgcagtggtccatatgcttcggccttgttgtatatatgtaaatatatgccatggtgtttttgaatagcaggcatctctaatctgtaagagtgttgtagcgcgaatcaccaagataagcctgagaaaataaccggagagcttttctttgt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055060.1 RefSeq:Os02g0818000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

@@ Line 1: / Line 1: @@
-The rice '''''Os02g0818000''''' was reported as '''''UIP1''''' in 2013 <ref name="ref1" /> by researchers from Korea.
+The rice '''''Os02g0818000''''' was reported as '''''OsCBSX3a''''' in 2009 <ref name="ref1" /> by researchers from India.
 ==Annotated Information==
 ===Gene Symbol===
-*'''''Os02g0818000''''' '''''<=>''''' '''''OsUIP1,UIP1'''''
+*'''''Os02g0818000''''' '''''<=>''''' '''''OsCBSX3a'''''
 ===Function===
-* The rice '''''UIP1''''' encodes a novel RNA-binding protein (RBP) possessing a CBS (cystathionine-b-synthase) domain.
+* CBS domains are found to be associated with several proteins of unrelated functions, such as inosine-5'-mono- phosphate dehydrogenase (IMPDH), AMP-activated protein kinase (AMPK), chloride channels (CLC) and cys-tathionine-β-synthase (CBS).
-* '''''UIP1''''' interacts with 3'-untranslated region of RbcS1 mRNA and increases tolerance of transgenic overexpressors to drought stress.
+* Mutation in CBS domains abolish or strongly reduce activation by SAM and cause homocystinuria.
+* CBS domain of γ-subunit of AMPK acts as sensor of cellular energy status and mutations cause a glycogen storage disease, which is clinically expressed as a familial hypertrophic cardiomyopathy.
-===Phenotypic analysis===
+===Evolution===
-* Transgenic overexpression of '''''UIP1''''' in rice resulted in an increase in tolerance to drought stress at the vegetative stage of growth. Under drought, high salt and low temperature conditions, the maximum photochemical efficiency of photosystem II (Fv/Fm ) of '''''UIP1''''' plants was higher than those of the nontransgenic plants.
+* CBS domain exists not only in archaebacterial proteins, but also in eubacterial and eukaryotic proteins
+* In CBS protein, C-terminal CBS domain exerts an autoin-hibitory effect on the CBS activity, while binding of SAM (S-adenosylmethionine) with CBS domain induces a conformational change which relieves the autoinhibitory effect.
 ==Labs working on this gene==
-*School of Biotechnology and Environmental Engineering,  Myongji University, Yongin 449-728, Korea
+* Centre for Computational Biology and Bioinformatics, School of Information Technology, Jawaharlal Nehru University, New Delhi 110067, India
 ==References==
 <references>
 * <ref name="ref1">
-Park, Su-Hyun, et al. "Transgenic overexpression of UIP1, an interactor of the 3′ untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought." Plant biotechnology reports 7.1 (2013): 83-90.
+Kushwaha HR, Singh AK, Sopory SK, Singla-Pareek SL, Pareek A. Genome wide
 </ref>
 </references>

@@ Line 1: / Line 1: @@
-'''''UIP1''''' (3'-UTR-interacting protein 1) acts as a chaperone protein of ''RbcS1'' transcripts by associating with the RbcS1 3'-UTR in an event of SMD leading them to either PBs or SGs<ref name="ref1"/>.
+The rice '''''Os02g0818000''''' was reported as '''''UIP1''''' in 2013 <ref name="ref1" /> by researchers from Korea.
 ==Annotated Information==
 ===Function===
 * The rice '''''UIP1''''' encodes a novel RNA-binding protein (RBP) possessing a CBS (cystathionine-b-synthase) domain.
@@ Line 15: / Line 17: @@
 Park, Su-Hyun, et al. "Transgenic overexpression of UIP1, an interactor of the 3′ untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought." Plant biotechnology reports 7.1 (2013): 83-90.
 </ref>
 </references>

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Function===
-The '''CBS domain''' of ''UIP1'' is necessary for '''binding to 3' ''RbcS'''''. ''UIP1'' interacts with 3' untranslated region of ''RbcS1'' mRNA and '''increases tolerance''' of transgenic overexpressors to '''drought stress'''<ref name="ref1"/>.
+* The rice '''''UIP1''''' encodes a novel RNA-binding protein (RBP) possessing a CBS (cystathionine-b-synthase) domain.
-===Mutation===
+===Phenotypic analysis===
-transgenic and nontransgenic (NT) control plants<ref name="ref1"/>:
+* Transgenic overexpression of '''''UIP1''''' in rice resulted in an increase in tolerance to drought stress at the vegetative stage of growth. Under drought, high salt and low temperature conditions, the maximum photochemical efficiency of photosystem II (Fv/Fm ) of '''''UIP1''''' plants was higher than those of the nontransgenic plants.
 ==Labs working on this gene==
 *School of Biotechnology and Environmental Engineering,  Myongji University, Yongin 449-728, Korea
-==Structured Information==
+</references>
 ==Structured Information==

@@ Line 22: / Line 22: @@
 *School of Biotechnology and Environmental Engineering,  Myongji University, Yongin 449-728, Korea
-==References==
+==Structured Information==
-<references>
+     [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
 ==Structured Information==

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+'''''UIP1''''' (3'-UTR-interacting protein 1) acts as a chaperone protein of ''RbcS1'' transcripts by associating with the RbcS1 3'-UTR in an event of SMD leading them to either PBs or SGs<ref name="ref1"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+The '''CBS domain''' of ''UIP1'' is necessary for '''binding to 3' ''RbcS'''''. ''UIP1'' interacts with 3' untranslated region of ''RbcS1'' mRNA and '''increases tolerance''' of transgenic overexpressors to '''drought stress'''<ref name="ref1"/>.
 ===Expression===
-Please input expression information here.
+*Transgenic overexpression of ''UIP1'' in rice resulted in an '''increase in tolerance to drought stress''' at the '''vegetative stage''' of growth. Under '''drought''', '''high salt''' and '''low temperature''' conditions, the maximum photochemical efficiency of photosystem II (Fv/Fm) of UIP1 plants was '''higher''' than those of the nontransgenic plants<ref name="ref1"/>.
-===Evolution===
+*Interestingly, the effect of ''UIP1'' overexpression on tolerance to stress was much '''more pronounced''' under drought than under high salt and low temperature conditions<ref name="ref1"/>.
-You can also add sub-section(s) at will.
+===Knowledge Extension===
 ==Labs working on this gene==
-Please input related labs here.
+*School of Biotechnology and Environmental Engineering,  Myongji University, Yongin 449-728, Korea
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 19:25, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os02g0818000\|		GeneName = Os02g0818000\|