Os02g0823100 - Revision history

Xysj2019: /* Labs working on this gene */

2017-02-24T03:03:18Z

‎Labs working on this gene

Xysj2019 at 03:02, 24 February 2017

2017-02-24T03:02:59Z

Xysj2019 at 02:59, 24 February 2017

2017-02-24T02:59:07Z

192.168.72.52 at 06:55, 14 May 2015

2015-05-14T06:55:00Z

Xysj2012: /* Structured Information */

2015-05-14T06:04:48Z

‎Structured Information

Zhangye at 12:03, 1 March 2015

2015-03-01T12:03:09Z

124.16.129.48 at 19:25, 22 July 2012

2012-07-22T19:25:52Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os02g0823100| Description = Similar to Plasma membrane intrinsic protein (Plasma membrane integral protein ZmPIP1-5)| Version = NM_001055101.1 GI..."

2012-06-25T03:01:43Z

Created page with "{{JaponicaGene| GeneName = Os02g0823100| Description = Similar to Plasma membrane intrinsic protein (Plasma membrane integral protein ZmPIP1-5)| Version = NM_001055101.1 GI..."

New page

{{JaponicaGene|
GeneName = Os02g0823100|
Description = Similar to Plasma membrane intrinsic protein (Plasma membrane integral protein ZmPIP1-5)|
Version = NM_001055101.1 GI:115449846 GeneID:4331194|
Length = 1549 bp|
Definition = Oryza sativa Japonica Group Os02g0823100, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:36236534..36238082|
CDS = 36236683..36237453,36237687..36237782|
GCID = <gbrowseImage1>
name=NC_008395:36236534..36238082
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:36236534..36238082
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggaggggaaggaggaggatgtgaggctgggggcgaacaggtacacggagaggcagccgatcgggacggcggcgcagggggcggaggagaaggactaccgggagccgccggcggcgccggtgttcgaggtggaggagctgacgtcgtggtcgttctaccgggcggggatcgcggagttcgtggcgacgttcctgttcctgtacatcagcatcctgacggtgatgggggtgaacaagtcggcgtccaagtgcgccaccgtggggatccagggcatcgcgtggtcgttcggcggcatgatcttcgcgctcgtctactgcaccgccggcatctccggcgggcacatcaacccggcggtgacgttcgggctgttcctggcgcggaagctgtcgctgacgcgggcggtgttctacatggcgatgcagtgcctgggcgccatctgcggcgccggcgtggtgaaggggttccagcgggggttgtacatgggctccggcggcggcgccaacgccgtgaacccggggtacaccaagggggacgggctcggggcggagatcgtgggcaccttcgtcctcgtctacaccgtcttctccgccaccgacgccaagcgcaacgccagggactcccacgtccccatcctggcgccgctccccatcggcttcgccgtcttcctcgtccacctcgccaccatccccatcaccggcaccggcatcaaccccgcccgcagcctcggcgccgccatcgtctataaccgcgcccacgcatggcacgaccactggattttctgggttggtccgttcatcggagcggcactggcggccatctaccacgtggtggtgatcagagcaatccccttcaagagccgggactaa</cdnaseq>|
AA = <aaseq>MEGKEEDVRLGANRYTERQPIGTAAQGAEEKDYREPPAAPVFEV EELTSWSFYRAGIAEFVATFLFLYISILTVMGVNKSASKCATVGIQGIAWSFGGMIFA LVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMAMQCLGAICGAGVVKGFQRGLY MGSGGGANAVNPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRNARDSHVPILAPLPIG FAVFLVHLATIPITGTGINPARSLGAAIVYNRAHAWHDHWIFWVGPFIGAALAAIYHV VVIRAIPFKSRD</aaseq>|
DNA = <dnaseqindica>150..920#1154..1249#gtggagcaggagctataaaaagaagcaggaagccactcgctctcctcacagccacagctcgccatcgtcgtcgtcgtcgtcgtcgtctccggctccggcaagagagctagtagtgagtagtagaaagaagaagaggcaaattaatagtaatggaggggaaggaggaggatgtgaggctgggggcgaacaggtacacggagaggcagccgatcgggacggcggcgcagggggcggaggagaaggactaccgggagccgccggcggcgccggtgttcgaggtggaggagctgacgtcgtggtcgttctaccgggcggggatcgcggagttcgtggcgacgttcctgttcctgtacatcagcatcctgacggtgatgggggtgaacaagtcggcgtccaagtgcgccaccgtggggatccagggcatcgcgtggtcgttcggcggcatgatcttcgcgctcgtctactgcaccgccggcatctccggcgggcacatcaacccggcggtgacgttcgggctgttcctggcgcggaagctgtcgctgacgcgggcggtgttctacatggcgatgcagtgcctgggcgccatctgcggcgccggcgtggtgaaggggttccagcgggggttgtacatgggctccggcggcggcgccaacgccgtgaacccggggtacaccaagggggacgggctcggggcggagatcgtgggcaccttcgtcctcgtctacaccgtcttctccgccaccgacgccaagcgcaacgccagggactcccacgtccccatcctggcgccgctccccatcggcttcgccgtcttcctcgtccacctcgccaccatccccatcaccggcaccggcatcaaccccgcccgcagcctcggcgccgccatcgtctataaccgcgcccacgcatggcacgaccacgtatgcaaccaaccattatttaatgctttctcaactacttagctactccatccatccgataaaaaaccaatcggaacgtgacacattctattattatgtatctgaatatatatatactatctaaattcatcgtacaaaattcgttttttatgggatttgagggagtagttgctaataatcacacgttaatttagttcattgattagtgctaattgatggatggatttgtgcagtggattttctgggttggtccgttcatcggagcggcactggcggccatctaccacgtggtggtgatcagagcaatccccttcaagagccgggactaattaattaccatgcaccatcatcttaattaagcgataattactctgaaataatcaaccgagttgatgctgcaagatgatggaggatcaagtctctacagtactacgtgtgttattaccgtctggtgatcgatgaagctagccgctgcataattataagcgcgtttatatatatctgatgttgctgtaattatatctatgtgtacgtagtatgtttggtgtgagaaatggtacttgtgtgtgcggaggcatgcatgttcttggttgcacgccttcagctatatatagctttgcatcaattcc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055101.1 RefSeq:Os02g0823100]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

@@ Line 45: / Line 45: @@
 *Plant Cell Biotechnology Laboratory, Korea Research Institute of Bioscience and Biotechnology, Oun-dong 52, Yusong, Taejon, 305-333 Korea
 <references>
 * <ref name="ref1">

@@ Line 1: / Line 1: @@
-The rice gene ''Os02g0823100'' was reported as '''''RWC3''''' in 2004<ref name="ref1"/><ref name="ref2"/>, '''''OsPIP1-3''''' in 2011<ref name="ref3"/>, respectively.
+The rice gene ''Os02g0823100'' was reported as '''''RWC3''''' in 2004<ref name="ref1"/>.
 ==Annotated Information==
@@ Line 9: / Line 9: @@
 *''RWC3'' was a '''water channel protein''' that facilitated water flux across membranes. It probably played a role in '''drought avoidance''' in rice<ref name="ref1"/>.
-*Gibberellin ('''GA''') '''enhanced''' the '''GUS activity''' in the '''transgenic calli''', '''suspension cells''' and '''leaves''', whereas ancymidol ('''anc'''), an inhibitor of GA synthesis, '''reduced''' the GUS activity. Sucrose was found to inhibit the effects induced by addition of GA, suggesting a '''possible cross-talk''' between '''GA''' and '''sucrose signaling''' on regulation of the ''RWC3'' gene expression<ref name="ref2"/>.
+*Gibberellin ('''GA''') '''enhanced''' the '''GUS activity''' in the '''transgenic calli''', '''suspension cells''' and '''leaves''', whereas ancymidol ('''anc'''), an inhibitor of GA synthesis, '''reduced''' the GUS activity. Sucrose was found to inhibit the effects induced by addition of GA, suggesting a '''possible cross-talk''' between '''GA''' and '''sucrose signaling''' on regulation of the ''RWC3'' gene expression<ref name="ref1"/>.
-*The PCR was performed with the Pfu high fidelity Taq DNA polymerase so that a blunt-ended product was obtained and cloned into SmaI site of the pCAMBIA1381Z vector (Fig.1), forming the RWC3 promoter guided GUS report gene expression construct. The ''RWC3'' promoter was thereafter '''cloned into''' the pCAMBIA1381Z vector, and its orientation was verified by sequencing and restricted enzyme cutting<ref name="ref2"/>.
+*The PCR was performed with the Pfu high fidelity Taq DNA polymerase so that a blunt-ended product was obtained and cloned into SmaI site of the pCAMBIA1381Z vector (Fig.1), forming the RWC3 promoter guided GUS report gene expression construct. The ''RWC3'' promoter was thereafter '''cloned into''' the pCAMBIA1381Z vector, and its orientation was verified by sequencing and restricted enzyme cutting<ref name="ref1"/>.
 '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0005215 GO:0005215],[http://amigo.geneontology.org/amigo/term/GO:0006810 GO:0006810], [http://amigo.geneontology.org/amigo/term/GO:0016020 GO:0016020], [http://amigo.geneontology.org/amigo/term/GO:0016021 GO:0016021]
@@ Line 21: / Line 21: @@
 **The transgenic plants had approximately the equivalent amount of RWC3 mRNA or protein under non-stress conditions, while they had a clearly increased ''RWC3'' amount compared with the wild-type plants under the water deficit. The up-regulation of ''RWC3'' in these transgenic plants was dependent on water deficit condition.
 **However, no observable phenotypic difference was found between the transgenic plants and the wild-type plants, either under non-stress or during water deficit.
-*In the transgenic rice '''root''', GUS activity was shown in '''elongation''' and '''mature zones''', and was very significant in '''cells''' adjacent to the '''vascular bundles''', in '''exodermis''' and '''root hairs'''<ref name="ref2"/>.
+*In the transgenic rice '''root''', GUS activity was shown in '''elongation''' and '''mature zones''', and was very significant in '''cells''' adjacent to the '''vascular bundles''', in '''exodermis''' and '''root hairs'''<ref name="ref1"/>.
-*In the '''leaves''', GUS activity was found not '''only''' in '''leaf vascular bundles''', but also in '''mesophyll cells''', and the expression in the cells around vascular bundles appeared to be '''higher''' than inmesophyll cells. High GUS activity was also observed in '''stem tissue'''<ref name="ref2"/>.
+*In the '''leaves''', GUS activity was found not '''only''' in '''leaf vascular bundles''', but also in '''mesophyll cells''', and the expression in the cells around vascular bundles appeared to be '''higher''' than inmesophyll cells. High GUS activity was also observed in '''stem tissue'''<ref name="ref1"/>.
 ===Expression===
@@ Line 29: / Line 29: @@
 *The '''up-regulation''' of ''RWC3'' in upland rice fits well with the knowledge that upland rice adopts the mechanism of '''drought avoidance'''. The physiological significance of this ''RWC3'' up-regulation was then explored with the overexpression of ''RWC3'' in transgenic lowland rice controlled by a stressinducible SWPA2 promoter<ref name="ref1"/>.
-*Overexpression of ''RWC3'' '''enhanced the root osmotic Lp''' and i'''mproved water status''' during water deficit<ref name="ref1"/>. Expression of ''RWC3'' protein, as indicated by GUS staining intensity, was obviously '''high''' in '''immature embryo''' and the '''seed coat''', and GUS activity in '''seed coats''' could be detected even after the endosperm wasmature<ref name="ref2"/>.
+*Overexpression of ''RWC3'' '''enhanced the root osmotic Lp''' and i'''mproved water status''' during water deficit<ref name="ref1"/>. Expression of ''RWC3'' protein, as indicated by GUS staining intensity, was obviously '''high''' in '''immature embryo''' and the '''seed coat''', and GUS activity in '''seed coats''' could be detected even after the endosperm wasmature<ref name="ref1"/>.
-*The media inhibited the effect of '''GA''' on the expression of ''RWC3''<ref name="ref2"/>.
+*The media inhibited the effect of '''GA''' on the expression of ''RWC3''<ref name="ref1"/>.
-*Presence of sucrose repressed the ''RWC3'' expression, while incubation of the cells with the same concentration of mannitol for 48 h, which caused unfavorable growth conditions of the cells, stimulated the protein expression. The presence of GA ciselement in the promoter region of ''RWC3'' suggest a '''signaling of GA''' involving such stimulation of the ''RWC3'' expression, besides the water deficit-stimulated mechanism<ref name="ref2"/>.
+*Presence of sucrose repressed the ''RWC3'' expression, while incubation of the cells with the same concentration of mannitol for 48 h, which caused unfavorable growth conditions of the cells, stimulated the protein expression. The presence of GA ciselement in the promoter region of ''RWC3'' suggest a '''signaling of GA''' involving such stimulation of the ''RWC3'' expression, besides the water deficit-stimulated mechanism<ref name="ref1"/>.
 ===Knowledge Extension===
-'''Sugars''' somehow affect ''pZSS4'' and ''RWC3'' transcription. A plausible mechanism is the triggering of starch digestion by sugar deprivation or low sugar concentration. Endogenous '''GA levels''' would rise during this starch digestion, which promoting ''RWC3'' transcription in addition. Sugar levels may play a '''similar role''' in the aquapor in induction system<ref name="ref2"/>.
+'''Sugars''' somehow affect ''pZSS4'' and ''RWC3'' transcription. A plausible mechanism is the triggering of starch digestion by sugar deprivation or low sugar concentration. Endogenous '''GA levels''' would rise during this starch digestion, which promoting ''RWC3'' transcription in addition. Sugar levels may play a '''similar role''' in the aquapor in induction system<ref name="ref1"/>.
 ==Labs working on this gene==

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Function===
 [[File: RWC3 construct1.jpg|right|thumb|250px|'''Figure 1.''' ''The construct used for transformation.(from reference <ref name="ref1"/>).'']]
@@ Line 33: / Line 36: @@
 ===Knowledge Extension===
 '''Sugars''' somehow affect ''pZSS4'' and ''RWC3'' transcription. A plausible mechanism is the triggering of starch digestion by sugar deprivation or low sugar concentration. Endogenous '''GA levels''' would rise during this starch digestion, which promoting ''RWC3'' transcription in addition. Sugar levels may play a '''similar role''' in the aquapor in induction system<ref name="ref2"/>.
@@ Line 40: / Line 44: @@
 *Laboratory of Plant Genetic Engineering, Biotechnology Institute, Akita Prefectural University, Ogata, Akita, Japan
 *Plant Cell Biotechnology Laboratory, Korea Research Institute of Bioscience and Biotechnology, Oun-dong 52, Yusong, Taejon, 305-333 Korea
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
 [[Category:Genes]]

@@ Line 41: / Line 41: @@
 *Plant Cell Biotechnology Laboratory, Korea Research Institute of Bioscience and Biotechnology, Oun-dong 52, Yusong, Taejon, 305-333 Korea
-==References==
+==Structured Information==
-<references>
+     [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
 ==Structured Information==

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice gene ''Os02g0823100'' was reported as '''''RWC3''''' in 2004<ref name="ref1"/><ref name="ref2"/>, '''''OsPIP1-3''''' in 2011<ref name="ref3"/>, respectively.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+[[File: RWC3 construct1.jpg|right|thumb|250px|'''Figure 1.''' ''The construct used for transformation.(from reference <ref name="ref1"/>).'']]
 ===Expression===
-Please input expression information here.
+*The expression of water channel protein ''RWC3'' mRNA was '''increased''' in upland rice at the early response (up to 4 h) to the 20% polyethylene glycol ('''PEG''') 6000 treatment, whereas there was no significant expression changes in lowland rice. '''Protein levels''' were '''increased''' in upland rice and '''decreased''' in lowland rice at 10 h after the water deficit<ref name="ref1"/>.
-===Evolution===
+*Presence of sucrose repressed the ''RWC3'' expression, while incubation of the cells with the same concentration of mannitol for 48 h, which caused unfavorable growth conditions of the cells, stimulated the protein expression. The presence of GA ciselement in the promoter region of ''RWC3'' suggest a '''signaling of GA''' involving such stimulation of the ''RWC3'' expression, besides the water deficit-stimulated mechanism<ref name="ref2"/>.
-You can also add sub-section(s) at will.
+===Knowledge Extension===
 ==Labs working on this gene==
-Please input related labs here.
+*Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai, 200032, P. R. China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 19:25, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os02g0823100\|		GeneName = Os02g0823100\|