Os02g0830200 - Revision history

192.168.72.52 at 06:55, 14 May 2015

2015-05-14T06:55:35Z

Lianglei086: /* Labs working on this gene */

2014-06-04T13:34:38Z

‎Labs working on this gene

Lianglei086: /* Labs working on this gene */

2014-06-04T13:30:39Z

‎Labs working on this gene

Lianglei086: /* Labs working on this gene */

2014-06-04T13:30:08Z

‎Labs working on this gene

Lianglei086: /* References */

2014-06-04T13:29:20Z

‎References

Lianglei086: /* Evolution */

2014-06-04T13:27:25Z

‎Evolution

Lianglei086: /* Annotated Information */

2014-06-04T13:27:05Z

‎Annotated Information

124.16.129.48 at 19:26, 22 July 2012

2012-07-22T19:26:11Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os02g0830200| Description = Similar to ZmRR2 protein (Response regulator 2)| Version = NM_001055148.1 GI:115450023 GeneID:4331245| Length = 794 ..."

2012-06-25T03:02:40Z

Created page with "{{JaponicaGene| GeneName = Os02g0830200| Description = Similar to ZmRR2 protein (Response regulator 2)| Version = NM_001055148.1 GI:115450023 GeneID:4331245| Length = 794 ..."

New page

{{JaponicaGene|
GeneName = Os02g0830200|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001055148.1 GI:115450023 GeneID:4331245|
Length = 794 bp|
Definition = Oryza sativa Japonica Group Os02g0830200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:36576414..36577207|
CDS = 36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207|
GCID = <gbrowseImage1>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq>|
AA = <aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq>|
DNA = <dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055148.1 RefSeq:Os02g0830200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

← Older revision		Revision as of 06:55, 14 May 2015
Line 39:		Line 39:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0830200\|~~
−	~~Description = Similar to ZmRR2 protein (Response regulator 2)\|~~
−	~~Version = NM_001055148.1 GI:115450023 GeneID:4331245\|~~
−	~~Length = 794 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0830200, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:36576414..36577207\|~~
−	~~CDS = 36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:36576414..36577207~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:36576414..36577207~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq>\|
−	AA = <aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq>\|
−	DNA = <dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055148.1 RefSeq:Os02g0830200]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 14: / Line 14: @@
 Please input related labs here.
 .Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[3].
 [[File:FIG3.png]]

@@ Line 13: / Line 13: @@
 ==Labs working on this gene==
 Please input related labs here.
-.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
+.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[3].
 [[File:FIG3.png]]
@@ Line 19: / Line 19: @@
 at  23°C.  Error  bars  represent  SE  (N =  30).  D. Seeds  were  grown  on  plates  supplemented  with  the  specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.
-.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin.
+.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin[3].
 [[File:FIG4.png]]

@@ Line 13: / Line 13: @@
 ==Labs working on this gene==
 Please input related labs here.
 ==References==

@@ Line 16: / Line 16: @@
 ==References==
 Please input cited references here.
 ==Structured Information==

@@ Line 8: / Line 8: @@
 ===Evolution===
 Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
 [[File:FIG2.png]]

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-Please input function information here.
+OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].
 ===Expression===
-Please input expression information here.
+Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
 ===Evolution===
-Please input evolution information here.
+Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
+[[File:FIG2.png]]
 ==Labs working on this gene==

← Older revision		Revision as of 19:26, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os02g0830200\|		GeneName = Os02g0830200\|