Os03g0180800 - Revision history

Zhennan: /* Background */

2016-07-01T09:28:22Z

‎Background

Zhennan at 09:21, 1 July 2016

2016-07-01T09:21:54Z

Zhennan: /* Subcellular localization */

2016-07-01T09:19:24Z

‎Subcellular localization

Xysj2012 at 15:58, 30 June 2016

2016-06-30T15:58:41Z

Rice2012: /* Structured Information */

2015-06-12T05:04:57Z

‎Structured Information

Zhangye: /* Evolution */

2015-03-02T07:29:16Z

‎Evolution

Zhangye at 07:17, 2 March 2015

2015-03-02T07:17:33Z

124.16.129.48 at 19:29, 22 July 2012

2012-07-22T19:29:38Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os03g0180800| Description = ZIM domain containing protein| Version = NM_001055701.1 GI:115451130 GeneID:4331832| Length = 1035 bp| Definition =..."

2012-06-24T12:23:03Z

Created page with "{{JaponicaGene| GeneName = Os03g0180800| Description = ZIM domain containing protein| Version = NM_001055701.1 GI:115451130 GeneID:4331832| Length = 1035 bp| Definition =..."

New page

{{JaponicaGene|
GeneName = Os03g0180800|
Description = ZIM domain containing protein|
Version = NM_001055701.1 GI:115451130 GeneID:4331832|
Length = 1035 bp|
Definition = Oryza sativa Japonica Group Os03g0180800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
AP = Chromosome 3:4210340..4211374|
CDS = 4210735..4211274|
GCID = <gbrowseImage1>
name=NC_008396:4210340..4211374
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008396:4210340..4211374
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctga</cdnaseq>|
AA = <aaseq>MASTDPMTRRFAVACGVLSQYVKANSSQPSTAAPVAQGVSGLMA AAAAAAAAPVVQEPGCEVDGGGQQFTIFYAGKVVVIDRCTPAMAAELMRFASAAQGGG GAPEAPPALVDMPIARKASLKRFLAKRKATPASARSSYVVRAAAAEEEQPPAKKAKAA VERREDWLALGSLGHMHSR</aaseq>|
DNA = <dnaseqindica>101..640#atatgtgatcagcgacgtacagtacagatcgttcgcaataaagttagacttctcgtctctctttgtgcttgtgcttagttgtccgtgctagaagacggcaatggcgtcgacggatcccatgacccgccgcttcgccgtcgcgtgcggcgtgctcagccagtacgtcaaggccaactcctcgcagccgtcgacggcggcgccggtggctcaaggtgtgagtggcctcatggccgccgccgccgccgccgccgcggcgcctgtggtccaggaacccggatgcgaggtggacggcggggggcagcagttcacgatcttctacgccgggaaggtggtggtgatcgaccgctgcacgccggccatggcggccgagctgatgcggttcgcgtcggcggcgcagggcggcggcggcgcgccagaggcgccgcccgcgctggtggacatgccgatcgcgaggaaggcgtcgctgaagcggttcctggcgaagcgcaaggccacccccgcctccgcgcggtcgtcgtacgtcgtccgtgctgcggcggcggaggaggagcagccgccggcgaagaaagcgaaggcggccgtggagaggcgcgaggattggctcgcgctgggaagccttggacacatgcactcgcgctgatgatcatcgccacgacgtcacgtctgcgatttgagaattgagagctcgatcgattgatcgccatgtggtcacccggtagccgatgctgcaaggccggtcgagttggaagatggttctcgtcgcattaacggccttgagttgatttcgccgagcctgaccttgagttgattaccatggaagtatgaagatttcgtgattagcagttaccctagttatcgcggcgtataattaagcacggtcactgaagcgcaatggccttgagtcggtagatcaggactagagaggggtgtatggatctgacaagtactgtagtatattgtatcccgtttgaattttttttcgattcctatggggactgaattgattaatgatataaaattccttcgactgttctg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055701.1 RefSeq:Os03g0180800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 3]]
[[Category:Chromosome 3]]

← Older revision		Revision as of 09:28, 1 July 2016
Line 2:		Line 2:

	==Background==		==Background==
		+	* The TIFY family is a novel plant-specific gene family involved in the regulation of diverse plant-specific biologic processes, such as development and responses to phytohormones, in Arabidopsis. However, there is limited information about this family in monocot species. This report identifies 20 TIFY genes in rice, the model monocot species. Sequence analysis indicated that rice TIFY proteins have conserved motifs beyond the TIFY domain as was previously shown in Arabidopsis. On the basis of their protein structures, members of the TIFY family can be divided into two groups. Transcript level analysis of OsTIFY genes in tissues and organs revealed different tempo- spatial expression patterns, suggesting that expression and function vary by stage of plant growth and development. Most of the OsTIFY genes were predominantly expressed in leaf. Nine OsTIFY genes were responsive to jasmonic acid and wounding treatments.
		+	* The TIFY family is a novel plant-specific gene family recently identified in Arabidopsis. This family owes its name to a conserved TIFY domain with a highly conserved amino acid pattern of TIF [F/Y] XG in the protein sequences. The first gene identified from the TIFY family was originally reported as ZIM (Zinc-finger protein expressed in Inflorescence Meristem; At4g24470), which contains a C2C2-GATA zinc-finger. The nomenclature for TIFY, ZIM, and C2C2-GATA gene families had long been confusing, until Vanholme et al. (2007) conducted systematic sequence analysis to increase clarity. They identified all putative TIFY domain-containing members in Arabidopsis and introduced the name TIFY for the family.
		+	* Recently, a subfamily of TIFY named JAZ (JASMO-NATE ZIM-DOMAIN) has been intensively investigated for its proteins’ roles as key regulators of jasmonate hormonal response in Arabidopsis. The 12 members of this subfamily contain the TIFY domain and a C-terminal conserved domain designated as Jas which has a characteristic motif of SLX 2 FX 2 KRX 2 RX 5 PY. Thines et al. (2007) and Chini et al. (2007) firstly reported the function of JAZs in Arabidopsis. Over-expression of a truncated JAZ1 gene lacking the Jas domain and the mutant of JAI3/JAZ3 gene (At3g17860), which encodes an aberrant protein also lacking the Jas domain but including 14 extra amino acids, showed a dominant jasm-onate-insensitive phenotype. The degradation of these JAZs was induced by JA in vivo, and JA-IIe was shown to promote CORONATINE-INSENSITIVE1 (COI1)-JAZ1 interaction in vitro. These pivotal findings established that JAZ proteins are targets for jasmonate-dependent degradation via the SCF COI1 26S proteasome pathway. The JAI3 was also found to interact with AtMYC2, which can regulate JAI3 gene expression via feedback.

	==Annotated Information==		==Annotated Information==

← Older revision		Revision as of 09:21, 1 July 2016
Line 1:		Line 1:
	The rice gene ''Os03g0180800'' was reported as '''''OsTIFY11a''''' in 2008<ref name="ref1"/>, '''''ZIM-3''''' in 2013<ref name="ref2"/>, '''''OsJAZ3''''' in 2013<ref name="ref3"/><ref name="ref4"/>, respectively.		The rice gene ''Os03g0180800'' was reported as '''''OsTIFY11a''''' in 2008<ref name="ref1"/>, '''''ZIM-3''''' in 2013<ref name="ref2"/>, '''''OsJAZ3''''' in 2013<ref name="ref3"/><ref name="ref4"/>, respectively.
		+
		+	==Background==

	==Annotated Information==		==Annotated Information==

@@ Line 29: / Line 29: @@
 ===Subcellular localization===
-The transient gene expression assay using ''Arabidopsis'' mesophyll protoplasts showed that the ''OsTIFY11a''-GFP fusion protein was colocalized with the reported rice transcription factor Ghd7 in the '''nucleus''', suggesting that ''OsTIFY11a'' is '''a nuclear protein'''<ref name="ref1"/>.
+* The transient gene expression assay using ''Arabidopsis'' mesophyll protoplasts showed that the ''OsTIFY11a''-GFP fusion protein was colocalized with the reported rice transcription factor Ghd7 in the '''nucleus''', suggesting that ''OsTIFY11a'' is '''a nuclear protein'''<ref name="ref1"/>.
 ===Evolution===

← Older revision		Revision as of 15:58, 30 June 2016
Line 1:		Line 1:
−	The rice gene ''Os03g0180800'' was reported as '''''OsTIFY11a''''' in 2008<ref name="ref1"/>, ~~a '''JA signaling gene''' and~~ '''''ZIM-3''''' in 2013<ref name="ref2"/>, '''''OsJAZ3''''' in 2013<ref name="ref3"/><ref name="ref4"/>, respectively.	+	The rice gene ''Os03g0180800'' was reported as '''''OsTIFY11a''''' in 2008<ref name="ref1"/>, '''''ZIM-3''''' in 2013<ref name="ref2"/>, '''''OsJAZ3''''' in 2013<ref name="ref3"/><ref name="ref4"/>, respectively.

	==Annotated Information==		==Annotated Information==

@@ Line 32: / Line 32: @@
 ===Evolution===
 *A few ''OsTIFY'' gene clusters, including two OsTIFY gene clusters (''OsTIFY11a'', ''OsTIFY11b'', and O''sTIFY11c''; ''OsTIFY11g'' and ''OsTIFY10a''), on chromosome 3 and one gene cluster (''OsTIFY11e'', ''OsTIFY11f'', and ''OsTIFY11d'') on chromosome 10<ref name="ref1"/>.
 *''OsTIFY11a'' contains '''a TIFY domain''' and '''a Jas motif''', but two amino acids (Pro and Tyr) that were identified in the Jas motif are absent in ''OsTIFY11a''<ref name="ref1"/>.
 ===Knowledge Extension===

@@ Line 65: / Line 65: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice gene ''Os03g0180800'' was reported as '''''OsTIFY11a''''' in 2008<ref name="ref1"/>, a '''JA signaling gene''' and '''''ZIM-3''''' in 2013<ref name="ref2"/>, '''''OsJAZ3''''' in 2013<ref name="ref3"/><ref name="ref4"/>, respectively.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*For ''OsTIFY11a'', the PCR products were '''cloned into''' p1301H (modified based on pCAMBIA1301) which has the stress-inducible promoter of ''OsLEA3-I''<ref name="ref1"/><ref name="ref5"/>.
 ===Expression===
-Please input expression information here.
+*The full length cDNA of ''OsTIFY11a'' for overexpression was '''isolated from''' ''indica'' rice Minghui 63 and '''encodes''' a protein with the sequence as from ''japonica'' rice. ''OsTIFY11a'' and ''OsTIFY11e'' had '''similar induction dynamics''': the induced expression peaked at 0.5 h after '''JA treatment'''<ref name="ref1"/>.
 ===Evolution===
-Please input evolution information here.
+*A few ''OsTIFY'' gene clusters, including two OsTIFY gene clusters (''OsTIFY11a'', ''OsTIFY11b'', and O''sTIFY11c''; ''OsTIFY11g'' and ''OsTIFY10a''), on chromosome 3 and one gene cluster (''OsTIFY11e'', ''OsTIFY11f'', and ''OsTIFY11d'') on chromosome 10<ref name="ref1"/>.
-You can also add sub-section(s) at will.
+===Knowledge Extension===
 ==Labs working on this gene==
-Please input related labs here.
+*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, 430070 Wuhan, China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 19:29, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os03g0180800\|		GeneName = Os03g0180800\|