Os03g0182800 - Revision history

Xysj1980 at 09:02, 23 March 2017

2017-03-23T09:02:13Z

Rice2012: /* Structured Information */

2015-06-12T05:05:38Z

‎Structured Information

Linyanxiang: /* References */

2014-06-03T08:56:14Z

‎References

Linyanxiang: /* Labs working on this gene */

2014-06-03T08:55:19Z

‎Labs working on this gene

Linyanxiang: /* Structured Information */

2014-06-03T08:53:41Z

‎Structured Information

Linyanxiang: /* Expression */

2014-06-03T08:51:00Z

‎Expression

Linyanxiang: /* Function */

2014-06-03T08:49:01Z

‎Function

124.16.129.48 at 19:29, 22 July 2012

2012-07-22T19:29:38Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os03g0182800| Description = Similar to Ethylene responsive element binding factor3 (OsERF3)| Version = NM_001055711.1 GI:115451150 GeneID:4331843..."

2012-06-24T12:23:13Z

Created page with "{{JaponicaGene| GeneName = Os03g0182800| Description = Similar to Ethylene responsive element binding factor3 (OsERF3)| Version = NM_001055711.1 GI:115451150 GeneID:4331843..."

New page

{{JaponicaGene|
GeneName = Os03g0182800|
Description = Similar to Ethylene responsive element binding factor3 (OsERF3)|
Version = NM_001055711.1 GI:115451150 GeneID:4331843|
Length = 1992 bp|
Definition = Oryza sativa Japonica Group Os03g0182800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
AP = Chromosome 3:4322061..4324052|
CDS = 4322456..4322739,4323187..4323609,4323725..4323998|
GCID = <gbrowseImage1>
name=NC_008396:4322061..4324052
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008396:4322061..4324052
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtgcggcggtgcaatcctcgccgatttcaccccggcgagggtgccccggcggctgaccgccgccgagctcctgccggtgaccccgactccccccgccgccgagaggagaaccacccggaagcgcaagtccgacgtcgacttcgaggcggagttcgagcttttcgaggacgacgacgacgacgatgagttcgagctttccgacgatggcgacgagagtttggccgtgtcatgtgtgtcgtcccccaagtcgaaggcagtaccttcgttttctttttcgtcggatgtctcctcgagctccaggccgcggcggcgcgtggcggcggcggcggccggtcgtcggaaggcgagcaagaagagcaagtacaggggcgtccggcgccggccgtcggggaggttcgcggcggagatcagggaccccaagaaggggcggcgcgtgtggctcggcacgtacggcagcgccgaggaggccgccatggcctacgaccgcgaggcccgccgcatccgcggcaagggcgcgaggctcaacttcccccgcgacggcgatggctcccctcgccggagtaacgaccggccctgctggaccatcgacctcaacctccccgcggcggccgtctccggtgacgacgacgacgccatggccgtcgacgccgcagacgcagacgcaggcagtgctggccgtgcagcagcctatgcagatcaagaagcactgagcgcggcaaagtgcaagatcaagcagtgtcctcgcgacgaacagatggcgagcgccacacctgagctcatggaggaggacgcgagcagcagcagaaacatggtgcccctgtccatggcgctgcagctgcagtatgcggcgatgatcgccgaatgcgaccgcgagatggaggagatcgccgccgtggagagggacctcgagaggcgcaggaggcaggtgttcgagcgcagaggccacctggtcaggcaggcctctcttctgctcgactga</cdnaseq>|
AA = <aaseq>MCGGAILADFTPARVPRRLTAAELLPVTPTPPAAERRTTRKRKS DVDFEAEFELFEDDDDDDEFELSDDGDESLAVSCVSSPKSKAVPSFSFSSDVSSSSRP RRRVAAAAAGRRKASKKSKYRGVRRRPSGRFAAEIRDPKKGRRVWLGTYGSAEEAAMA YDREARRIRGKGARLNFPRDGDGSPRRSNDRPCWTIDLNLPAAAVSGDDDDAMAVDAA DADAGSAGRAAAYADQEALSAAKCKIKQCPRDEQMASATPELMEEDASSSRNMVPLSM ALQLQYAAMIAECDREMEEIAAVERDLERRRRQVFERRGHLVRQASLLLD</aaseq>|
DNA = <dnaseqindica>1314..1597#444..866#55..328#cccgcgtcgcgccatagcgacgtctctcccggagaaagaagagcgcgccgcgccatgtgcggcggtgcaatcctcgccgatttcaccccggcgagggtgccccggcggctgaccgccgccgagctcctgccggtgaccccgactccccccgccgccgagaggagaaccacccggaagcgcaagtccgacgtcgacttcgaggcggagttcgagcttttcgaggacgacgacgacgacgatgagttcgagctttccgacgatggcgacgagagtttggccgtgtcatgtgtgtcgtcccccaagtcgaaggcagtaccttcgttttcttgtacgatgagatggagaaatcttgcctgctttcttgaaggattttcacctgacggcaacctgaactttacacgatttcttctcctgctgttgatttcatcgatcgccggcggcagtttcgtcggatgtctcctcgagctccaggccgcggcggcgcgtggcggcggcggcggccggtcgtcggaaggcgagcaagaagagcaagtacaggggcgtccggcgccggccgtcggggaggttcgcggcggagatcagggaccccaagaaggggcggcgcgtgtggctcggcacgtacggcagcgccgaggaggccgccatggcctacgaccgcgaggcccgccgcatccgcggcaagggcgcgaggctcaacttcccccgcgacggcgatggctcccctcgccggagtaacgaccggccctgctggaccatcgacctcaacctccccgcggcggccgtctccggtgacgacgacgacgccatggccgtcgacgccgcagacgcagacgcaggcagtgctggccgtgcagcagcctatgcaggtactaccacctcggaggatatctcaagatgtattaatacgtgatatatcactttgtaaatatgcatgtttaaaattaactcctacatctcaaaataaaataaaacaatttaattgtgaatatacgttaactagttatagtttaatttatttttttttcgtttttatttttttcgttgcgggagtagaagttgaatttgaatttgcatgtgtgctggcggagaaacttggctcgtaggctcgtagcatggagcattgccctgttcgcatcatatcatacggttgagctcgatttttgcgaaagaaagaaaggattccaatattctcactgatgaatgatgatcaaggttgataaaatgagcgaactcgatcaaaccaaaccaacaaatttcgaagaatcaagtagatttactaatgtattggcgttgttggcttgttgccgtcgcagatcaagaagcactgagcgcggcaaagtgcaagatcaagcagtgtcctcgcgacgaacagatggcgagcgccacacctgagctcatggaggaggacgcgagcagcagcagaaacatggtgcccctgtccatggcgctgcagctgcagtatgcggcgatgatcgccgaatgcgaccgcgagatggaggagatcgccgccgtggagagggacctcgagaggcgcaggaggcaggtgttcgagcgcagaggccacctggtcaggcaggcctctcttctgctcgactgacgatcttgctgaactgaactctgaatgtttgagcttgtctgaagtctgaactctgcactatgccatatggtgtttcaccttcactgtgaggctgacatgtgggccagacgtccgtttgccttgcttgcttttgagctgcaactgggcgttgtgctgcaagcctgcaaagtgcctgtgtaaagtttgtgggattgtgtgtgtggatcttgtatccttgtgactttgcaagctttaattttgtgaggaacaatagtattttagattggtgtgtaaaatatagaaataaataatagtagcaactaaattttggttttcagctcttcatcagatggtttgtcatgggaacaaaatttcaaacatgagcaaattaaggtcatgttattatcaattgtgat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055711.1 RefSeq:Os03g0182800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 3]]
[[Category:Chromosome 3]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os03g0182800''''' was reported as '''''OsERF#060''''' in 2006 <ref name="ref1" /> by researchers from Japan.
 ==Annotated Information==
 ===Function===
-OsDERF1 is a novel ERF protein of unknown function Multiple factors, including water potential and osmotic adjustment, affect plant water status and drought tolerance. To elucidate the molecular basis underlying drought response, transcript levels of genes were screened under drought conditions. Using expression
+* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
-data for stress treatment in rice seedlings (http://www.ricearray. org), 12 drought-responsive ERF genes (DERF) were identified (Table S1, GEO accession number GSE26280). One of the DERF genes, OsDERF1 (Os08g35240), located in rice chromosome 8, encodes a 243-amino-acid protein with predicted molecular mass of
+* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
-.8 kDa. Amino acid analysis indicated that the putative protein contains a typical ERF/AP2 domain at 26–91thamino acids, an activation domain at 161–180thamino acids, and a nuclear localization signal at 25–34thamino acids.
+* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
 ===Evolution===
-Please input evolution information here.
+* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China,
+* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
-National Key Facility of Crop Gene Resources and Genetic Improvement,Beijing, China,
+* Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
 ==References==
-Transcriptional Activation of OsDERF1 in OsERF3 and OsAP2-39 Negatively Modulates Ethylene Synthesis and Drought Tolerance in Rice
+<references>
-Liyun Wan1,2,3., Jianfei Zhang1,2,3., Haiwen Zhang1,2,3, Zhijin Zhang1,2,3, Ruidang Quan1,2,3, Shirong
+* <ref name="ref1">
-Zhou1,2,3, Rongfeng Huang1,2,3*
+Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
+gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
-==Structured Information==
+PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 [[Category:Genes]]

@@ Line 21: / Line 21: @@
 ==References==
-Please input cited references here.
+Transcriptional Activation of OsDERF1 in OsERF3 and OsAP2-39 Negatively Modulates Ethylene Synthesis and Drought Tolerance in Rice
 ==Structured Information==

@@ Line 16: / Line 16: @@
 ==Labs working on this gene==
-Please input related labs here.
+Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China,
 ==References==

@@ Line 8: / Line 8: @@
 ===Expression===
-Please input expression information here.
+The expression of OsDERF1 was highly induced (about fourfold) by ACC treatment at 1 h, and reached maximum induction at 2 h, then decreased (Figure 1A). And the transcripts of OsDERF1 in response to dehydration were quickly peaked at 0.5 h then decreased. Interestingly, the transcripts of OsDERF1 showed a second increase and peaked after dehydration induction for 3 h (Figure 1B). In addition, the expression of OsDERF1 obviously increased and peaked after ABA treatment for 1 h (Figure 1C). Further analysis revealed that OsDERF1 expression did not significantly alter when seedlings were subjected to salt and cold (data not shown), indicating that OsDERF1 might be associated with ethylene- and ABA-related drought response.
 ===Evolution===

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-Please input function information here.
+OsDERF1 is a novel ERF protein of unknown function Multiple factors, including water potential and osmotic adjustment, affect plant water status and drought tolerance. To elucidate the molecular basis underlying drought response, transcript levels of genes were screened under drought conditions. Using expression
 ===Expression===

@@ Line 23: / Line 23: @@
 ==Structured Information==
 {{JaponicaGene|
-GeneName = Os03g0182800|
+GeneName = OsERF3|
 Description = Similar to Ethylene responsive element binding factor3 (OsERF3)|
 Version = NM_001055711.1 GI:115451150 GeneID:4331843|

← Older revision		Revision as of 19:29, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os03g0182800\|		GeneName = Os03g0182800\|