Os03g0183000 - Revision history

Xysj1980 at 09:01, 23 March 2017

2017-03-23T09:01:04Z

Jxjjeremy123: /* Evolution */

2014-06-09T12:10:41Z

‎Evolution

Jxjjeremy123: /* Expression */

2014-06-09T12:10:27Z

‎Expression

Jxjjeremy123: /* Function */

2014-06-09T12:10:12Z

‎Function

Jxjjeremy123: /* References */

2014-06-09T12:06:38Z

‎References

Jxjjeremy123: /* References */

2014-06-09T12:00:50Z

‎References

Jxjjeremy123: /* Expression */

2014-06-09T11:53:14Z

‎Expression

Jxjjeremy123: /* References */

2014-06-09T07:05:54Z

‎References

Jxjjeremy123: /* References */

2014-06-09T07:04:27Z

‎References

Jxjjeremy123: /* Labs working on this gene */

2014-06-09T06:59:54Z

‎Labs working on this gene

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os03g0183000''''' was reported as '''''OsERF#062''''' in 2006 <ref name="ref1" /> by researchers from Japan.
 ==Annotated Information==
 ===Function===
-AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.
+* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
-In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP
+* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
-domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF
+* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
-[[File:OsRAF is an ERF-like gene.png]]
+===Evolution===
-OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants  observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale
+* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
-bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g<ref name="ref2" />
+* The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
+* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
-===Expression===
+* The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
-The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<ref name="ref3" />
+* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
-===Evolution===
+You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Research Center for Molecular & Developmental Biology, Key Laboratory of Photosynthesis & Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China
+* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
-== References ==
+==References==
 <references>
-<ref name="ref1">Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61</ref>
+* <ref name="ref1">
-<ref name="ref2">Banno H, Ikeda Y, Niu QW et al (2001) Overexpression of Arabidopsis ESR1 induces initiation of shoot regeneration.Plant Cell 13:2609–2618</ref>
+Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF
-<ref name="ref3">Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241</ref>
+gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
-<ref name="ref4">Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392</ref>
+PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 </references>

@@ Line 16: / Line 16: @@
 ===Evolution===
-In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.
+In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<ref name="ref4" />
 ==Labs working on this gene==

@@ Line 13: / Line 13: @@
 ===Expression===
-The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).
+The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<ref name="ref3" />
 ===Evolution===

@@ Line 6: / Line 6: @@
 In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP
 domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF
-accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.
+accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<ref name="ref1" />
 [[File:OsRAF is an ERF-like gene.png]]
 OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants  observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale
-bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g
+bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g<ref name="ref2" />
 ===Expression===
 The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).

← Older revision		Revision as of 12:06, 9 June 2014
Line 26:		Line 26:
	<ref name="ref3">Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241</ref>		<ref name="ref3">Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241</ref>
	<ref name="ref4">Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392</ref>		<ref name="ref4">Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392</ref>
		+	</references>

← Older revision		Revision as of 07:05, 9 June 2014
Line 18:		Line 18:

	==References==		==References==
−	~~<references>~~
−	~~<ref name="ref1">~~
	Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61		Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61
−
−	~~==Structured Information==~~
−	~~{{JaponicaGene\|~~
−	~~GeneName = Os03g0183000\|~~
−	~~Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)\|~~
−	~~Version = NM_001055712.1 GI:115451152 GeneID:4331845\|~~
−	~~Length = 1794 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 3\|Chromosome 3]]\|~~
−	~~AP = Chromosome 3:4327072..4328865\|~~
−	~~CDS = 4327660..4328399,4328509..4328773\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008396:4327072..4328865~~
−	~~source=RiceChromosome03~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008396:4327072..4328865~~
−	~~source=RiceChromosome03~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga</cdnaseq>\|
−	AA = <aaseq>MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF </aaseq>\|
−	DNA = <dnaseqindica>467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]\|~~
−	}}
−	~~[[Category:Genes]]~~
−	~~[[Category:Japonica mRNA]]~~
−	~~[[Category:Oryza Sativa Japonica Group]]~~
−	~~[[Category:Japonica Genes]]~~
−	~~[[Category:Japonica Chromosome 3]]~~
−	~~[[Category:Chromosome 3]]~~

@@ Line 18: / Line 18: @@
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==