Os03g0267200 - Revision history

Rice2012: /* Structured Information */

2015-06-12T05:39:02Z

‎Structured Information

Zhangye at 09:39, 3 March 2015

2015-03-03T09:39:53Z

124.16.129.48 at 19:32, 22 July 2012

2012-07-22T19:32:42Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os03g0267200| Description = Low molecular mass heat shock protein Oshsp17.7| Version = NM_001056197.1 GI:115452122 GeneID:4332363| Length = 707 ..."

2012-06-24T12:31:24Z

Created page with "{{JaponicaGene| GeneName = Os03g0267200| Description = Low molecular mass heat shock protein Oshsp17.7| Version = NM_001056197.1 GI:115452122 GeneID:4332363| Length = 707 ..."

New page

{{JaponicaGene|
GeneName = Os03g0267200|
Description = Low molecular mass heat shock protein Oshsp17.7|
Version = NM_001056197.1 GI:115452122 GeneID:4332363|
Length = 707 bp|
Definition = Oryza sativa Japonica Group Os03g0267200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
AP = Chromosome 3:8888484..8889190|
CDS = 8888694..8889173|
GCID = <gbrowseImage1>
name=NC_008396:8888484..8889190
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008396:8888484..8889190
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgctgatccgccgcggcaacgcgttcgaccccttctccctcgacctctgggatcccgtcgacggcttccccttcggctccggcggcagcagcagcagcagcggcagcctcttccctcgggccaactccgacgcggcggccttcgccggcgcgcgcatcgactggaaggagacgcccgaggtgcacgtgttcaaggcggacgtgccggggctgaagaaggaggaggtcaaggtggaggtggacgacggcaacatcctgcagatcagcggcgagcgcagcagggagcaggaggagaagtcggacaagtggcaccgcgtggagcgcagcagcggcaagttcctccgcaggttccgcctccccgagaacaccaagccggagcagatcaaggcgtccatggagaatggcgtgctcaccgtcaccgtgcccaaggaagagcccaagaagcccgacgtcaagtccatccagatctccggctag</cdnaseq>|
AA = <aaseq>MSLIRRGNAFDPFSLDLWDPVDGFPFGSGGSSSSSGSLFPRANS DAAAFAGARIDWKETPEVHVFKADVPGLKKEEVKVEVDDGNILQISGERSREQEEKSD KWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVLTVTVPKEEPKKPDVKSIQISG</aaseq>|
DNA = <dnaseqindica>18..497#gcccaaatccgtcaaccatgtcgctgatccgccgcggcaacgcgttcgaccccttctccctcgacctctgggatcccgtcgacggcttccccttcggctccggcggcagcagcagcagcagcggcagcctcttccctcgggccaactccgacgcggcggccttcgccggcgcgcgcatcgactggaaggagacgcccgaggtgcacgtgttcaaggcggacgtgccggggctgaagaaggaggaggtcaaggtggaggtggacgacggcaacatcctgcagatcagcggcgagcgcagcagggagcaggaggagaagtcggacaagtggcaccgcgtggagcgcagcagcggcaagttcctccgcaggttccgcctccccgagaacaccaagccggagcagatcaaggcgtccatggagaatggcgtgctcaccgtcaccgtgcccaaggaagagcccaagaagcccgacgtcaagtccatccagatctccggctagagccccgtttgtttattctgctgcttctcctcaatgctgcaattgatctcctcctttggtactttgcttgtgtcgtgagggacacagtccaaaatgtgtgtgatatgatcatgtgtttatgaatgtgtggtctcctccaagggtcccaaatgtgtttgtctcctatgcgtttatgtacgggaaataaactttaagcttgattaatgtacc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056197.1 RefSeq:Os03g0267200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 3]]
[[Category:Chromosome 3]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+'''''sHSP17.7''''' is a '''small heat-shock protein gene''' in rice<ref name="ref1"/><ref name="ref2"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+The '''molecular chaperone activity''' of ''sHSP17.7'' was investigated using catalase as a '''substrate'''. Recombinant ''sHSP17.7'' had '''heat-stable chaperone''' properties that were capable of '''protecting stressed catalase''' from '''precipitation'''<ref name="ref2"/>.
 ===Expression===
-Please input expression information here.
+*Western and Northern blot analyses showed '''higher expression levels''' of ''sHSP17.7'' protein in three transgenic lines than in one transgenic line. Overproduction of ''sHSP17.7'' could '''increase drought tolerance''' in transgenic rice seedlings. <ref name="ref1"/>. Overexpression of ''sHSP17.7'' in rice confers '''higher thermotolerance''' and '''UV-B resistance'''<ref name="ref2"/>.
 ===Evolution===
-Please input evolution information here.
+[[File: nine OsHSP genes.jpg|right|thumb|300px|'''Figure 1.'''''Gene tree of the nine rice HSPs(from reference <ref name="ref3"/>).'']]
-You can also add sub-section(s) at will.
+*Heat shock proteins (Hsps) belong to a class of proteins that are conserved in prokaryotes and eukaryotes and are especially abundant in plants. Hsps are highly expressed in plants and other organisms after being stimulated by high temperature and other stresses. The sHsps are much more abundant in higher plants than in other organisms<ref name="ref4"/>.
 ==Labs working on this gene==
-Please input related labs here.
+*National Agricultural Research Center for Hokkaido Region, Hitsujigaoka 1, Toyohira-ku, Sapporo 062-8555, Japan
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 19:32, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os03g0267200\|		GeneName = Os03g0267200\|

@@ Line 54: / Line 54: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]