<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/index.php?action=history&amp;feed=atom&amp;title=Os03g0766100</id>
		<title>Os03g0766100 - Revision history</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/index.php?action=history&amp;feed=atom&amp;title=Os03g0766100"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;action=history"/>
		<updated>2026-08-28T15:47:52Z</updated>
		<subtitle>Revision history for this page on the wiki</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=249016&amp;oldid=prev</id>
		<title>192.168.72.52: /* Structured Information */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=249016&amp;oldid=prev"/>
				<updated>2015-06-12T06:03:13Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Structured Information&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 06:03, 12 June 2015&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l45&quot; &gt;Line 45:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 45:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;==Structured Information==&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;==Structured Information==&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;{{JaponicaGene|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;GeneName = Os03g0766100|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Description = 10 kDa prolamin precursor|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Version = NM_001057915.1 GI:115455558 GeneID:4334227|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Length = 574 bp|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Definition = Oryza sativa Japonica Group Os03g0766100, complete gene.|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Source = Oryza sativa Japonica Group&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&amp;#160; ORGANISM&amp;#160; Oryza sativa Japonica Group&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; clade; Ehrhartoideae; Oryzeae; Oryza.&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;AP = Chromosome 3:32580334..32580907|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;CDS = 32580436..32580840|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;name=NC_008396:32580334..32580907&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;source=RiceChromosome03&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;preset=GeneLocation&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&amp;lt;/gbrowseImage1&amp;gt;|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;name=NC_008396:32580334..32580907&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;source=RiceChromosome03&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;preset=GeneLocation&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&amp;lt;/gbrowseImage2&amp;gt;|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;CDNA = &amp;lt;cdnaseq&amp;gt;atggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttga&amp;lt;/cdnaseq&amp;gt;|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;AA = &amp;lt;aaseq&amp;gt;MAAYTSKIFALFALIALSASATTAITTMQYFPPTLAMGTMDPCR&amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160;  QYMMQTLGMGSSTAMFMSQPMALLQQQCCMQLQGMMPQCHCGTSCQMMQSMQQVICAG&amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160; &amp;#160;  LGQQQMMKMAMQMPYMCNMAPVNFQLSSCGCC&amp;lt;/aaseq&amp;gt;|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;DNA = &amp;lt;dnaseqindica&amp;gt;68..472#atcatcctcaacaatattgtctacaccatctggaatcttgtttaacactagtattgtagaatcagcaatggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttgatcaaacgttggttacatgtactctagtaataaggtgttgcatactatcgtgtgcaaacactagaaataagaaccattgaataaaatatcaatcattttcaga&amp;lt;/dnaseqindica&amp;gt;|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057915.1 RefSeq:Os03g0766100]|&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;}}&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[Category:Genes]]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[Category:Genes]]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[Category:Japonica mRNA]]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[Category:Japonica mRNA]]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>192.168.72.52</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177582&amp;oldid=prev</id>
		<title>Littlescrew: /* Expression */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177582&amp;oldid=prev"/>
				<updated>2014-06-04T14:33:08Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Expression&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 14:33, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l11&quot; &gt;Line 11:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 11:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Fig. 2.jpg|right|thumb|430px|'''Fig 2.''' ''Fig. 2 Immunofluorescence microscopy of serial sections of PB-Is obtained from developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.. The numbers at the left of the image denote the order of the sections. The PBs in each section were labeled with antibodies against CysR10 and CysP13. The CysR10–antibody interactions were visualized with rhodamine-conjugated secondary antibodies (A–D), while those for CysP13s were visualized with FITC-conjugated secondary antibodies (E–H). (I–L) Merged images. The arrow indicates the location of the same PB in the serial sections. Bars: 4mm.'']]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Fig. 2.jpg|right|thumb|430px|'''Fig 2.''' ''Fig. 2 Immunofluorescence microscopy of serial sections of PB-Is obtained from developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.. The numbers at the left of the image denote the order of the sections. The PBs in each section were labeled with antibodies against CysR10 and CysP13. The CysR10–antibody interactions were visualized with rhodamine-conjugated secondary antibodies (A–D), while those for CysP13s were visualized with FITC-conjugated secondary antibodies (E–H). (I–L) Merged images. The arrow indicates the location of the same PB in the serial sections. Bars: 4mm.'']]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Crp10.jpg|right|thumb|430px|'''Fig 5.'''''&lt;del class=&quot;diffchange diffchange-inline&quot;&gt;Fig. 5 &lt;/del&gt;(I) Schematic images of PB-I structure during rice endosperm development(from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.'']] &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Crp10.jpg|right|thumb|430px|'''Fig 5.'''''(I) Schematic images of PB-I structure during rice endosperm development(from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.'']] &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177580&amp;oldid=prev</id>
		<title>Littlescrew: /* Expression */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177580&amp;oldid=prev"/>
				<updated>2014-06-04T14:32:11Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Expression&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 14:32, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l11&quot; &gt;Line 11:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 11:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Fig. 2.jpg|right|thumb|430px|'''Fig 2.''' ''Fig. 2 Immunofluorescence microscopy of serial sections of PB-Is obtained from developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.. The numbers at the left of the image denote the order of the sections. The PBs in each section were labeled with antibodies against CysR10 and CysP13. The CysR10–antibody interactions were visualized with rhodamine-conjugated secondary antibodies (A–D), while those for CysP13s were visualized with FITC-conjugated secondary antibodies (E–H). (I–L) Merged images. The arrow indicates the location of the same PB in the serial sections. Bars: 4mm.'']]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Fig. 2.jpg|right|thumb|430px|'''Fig 2.''' ''Fig. 2 Immunofluorescence microscopy of serial sections of PB-Is obtained from developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.. The numbers at the left of the image denote the order of the sections. The PBs in each section were labeled with antibodies against CysR10 and CysP13. The CysR10–antibody interactions were visualized with rhodamine-conjugated secondary antibodies (A–D), while those for CysP13s were visualized with FITC-conjugated secondary antibodies (E–H). (I–L) Merged images. The arrow indicates the location of the same PB in the serial sections. Bars: 4mm.'']]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;[[File:Crp10.jpg|right|thumb|430px|'''Fig 5.'''''Fig. 5 (I) Schematic images of PB-I structure during rice endosperm development(from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.'']] &lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177195&amp;oldid=prev</id>
		<title>Littlescrew: /* Expression */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177195&amp;oldid=prev"/>
				<updated>2014-06-04T08:29:10Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Expression&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 08:29, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l10&quot; &gt;Line 10:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 10:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Fig. 1.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:Fig. 1.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;[[File:Fig. 2.jpg|right|thumb|430px|'''Fig 2.''' ''Fig. 2 Immunofluorescence microscopy of serial sections of PB-Is obtained from developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.. The numbers at the left of the image denote the order of the sections. The PBs in each section were labeled with antibodies against CysR10 and CysP13. The CysR10–antibody interactions were visualized with rhodamine-conjugated secondary antibodies (A–D), while those for CysP13s were visualized with FITC-conjugated secondary antibodies (E–H). (I–L) Merged images. The arrow indicates the location of the same PB in the serial sections. Bars: 4mm.'']]&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177190&amp;oldid=prev</id>
		<title>Littlescrew at 08:26, 4 June 2014</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177190&amp;oldid=prev"/>
				<updated>2014-06-04T08:26:31Z</updated>
		
		<summary type="html">&lt;p&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 08:26, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l8&quot; &gt;Line 8:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 8:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Expression===&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Expression===&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:&lt;ins class=&quot;diffchange diffchange-inline&quot;&gt;Fig. 1&lt;/ins&gt;.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;[[File:Fig. 2jpg|right|thumb|430px|'''Figure 2.''' ''Immunofluorescence microscopy of serial sections of PB-Is obtained from developing rice endosperm at 3 WAF . The numbers at the left of the image denote the order of the sections. The PBs in each section were labeled with antibodies against CysR10 and CysP13. The CysR10–antibody interactions were visualized with rhodamine-conjugated secondary antibodies (A–D), while those for CysP13s were visualized with FITC-conjugated secondary antibodies (E–H). (I–L) Merged images. The arrow indicates the location of the same PB in the serial sections. Bars: 4mm.(from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.'']]&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177181&amp;oldid=prev</id>
		<title>Littlescrew: /* Expression */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177181&amp;oldid=prev"/>
				<updated>2014-06-04T08:23:39Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Expression&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 08:23, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l10&quot; &gt;Line 10:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 10:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;[[File:Fig. 2jpg|right|thumb|430px|'''Figure 2.''' ''Immunofluorescence microscopy of serial sections of PB-Is obtained from developing rice endosperm at 3 WAF . The numbers at the left of the image denote the order of the sections. The PBs in each section were labeled with antibodies against CysR10 and CysP13. The CysR10–antibody interactions were visualized with rhodamine-conjugated secondary antibodies (A–D), while those for CysP13s were visualized with FITC-conjugated secondary antibodies (E–H). (I–L) Merged images. The arrow indicates the location of the same PB in the serial sections. Bars: 4mm.(from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.'']]&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177170&amp;oldid=prev</id>
		<title>Littlescrew: /* Expression */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177170&amp;oldid=prev"/>
				<updated>2014-06-04T08:08:52Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Expression&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 08:08, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l12&quot; &gt;Line 12:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 12:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;The prolamin-containing PB-Is were non-spherical in the CysR10-repressed endosperm, because CysR10 is required for forming PB-Is into the spherical shape and for the compact size, and that it not only forms the central core but also interacts with other Cys-rich prolamins to assemble the concentric ring structure within the PB-I. In addition, RNAi suppression of CysR10 slightly reduced the expression level of CysP13, but CysR16 and CysR14 were normal or slightly higher amounts. However, Kawakatsu ''et al.''&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt; reported that their 10 kDa prolamin-suppressed plant accumulated substantially higher levels (about three times compared with the wild type) of CysR14 (RM1 and RM9) and CysR16 (RP16) prolamins than normal, although CysP13 (RM2 and RM4) prolamins were lower amounts. This different result may due to the differences of the methods used to regulate down the CysR10 expression level &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. One is the conventional RNAi method with the inverted CysR10 open reading frame, and the other one is the expression of a modified human Glucagon-like peptide-1 (GLP-1) to regulate down the target proteins. This elevated levels of CysR14 and CysR16 may compensate for the loss of CysR10 and contribute to form a rigid normal sized PB-I. Another consist result came from an endosperm storage protein mutant that contains reduced levels of CysR16, CysR14 and CysR10 and displays abnormal large PBIs.&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;Protein disulfide isomerase (PDI) family oxidoreductase PDIL2;3 knockdown inhibited the accumulation of Cys-rich 10-kD prolamin (crP10) in the core of PB-I. Conversely, crP10 (CysR10) knockdown dispersed PDIL2;3 into the endoplasmic reticulum lumen &amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Evolution===&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Evolution===&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177137&amp;oldid=prev</id>
		<title>Littlescrew: /* Expression */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177137&amp;oldid=prev"/>
				<updated>2014-06-04T07:22:56Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Expression&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 07:22, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l8&quot; &gt;Line 8:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 8:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Expression===&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Expression===&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:&lt;del class=&quot;diffchange diffchange-inline&quot;&gt;Fig_1&lt;/del&gt;.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;[[File:.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177136&amp;oldid=prev</id>
		<title>Littlescrew: /* Expression */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177136&amp;oldid=prev"/>
				<updated>2014-06-04T07:21:57Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Expression&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 07:21, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l8&quot; &gt;Line 8:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 8:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Expression===&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;===Expression===&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins style=&quot;font-weight: bold; text-decoration: none;&quot;&gt;[[File:Fig_1.jpg|right|thumb|430px|'''Fig 1.''' ''Distribution of CysR10 and CysP13 in PB-Is of developing rice endosperm at 3 WAF (from reference) &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. (D) The distribution of CysR10 as visualized using anti-CysR10 and rhodamine-conjugated secondary antibodies. (E) The localization of CysP13 using anti-CysP13 and FITC-conjugated secondary antibodies. (F) Merged image of D and E. Bars in (D–F): 10mm..'']]&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;Immunofluorescence light microscopy confirmed the spatial distribution of these prolamins within the PBs. CysR10 was visualized as small particles when labeled by anti-CysR10 followed by rhodamine-conjugated secondary antibodies (Fig. 1D). The distribution of CysR10 co-localized with CysP13, which was visualized with fluorescein isothiocyanate (FITC)-conjugated secondary antibodies (Fig. 1 E, F arrows). CysR10 was observed at the center of the PBs, whereas the distribution of CysP13 was more varied. Details about the spatial relationship between the prolamins were confirmed by immunofluorescence microscopy images from developing endosperm at 3 WAF (Fig. 2). They show that PB-I is composed of a center core of CysR10, surrounded by a middle layer of a mixture of CysR10 and CysP13, and then followed by a peripheral layer containing CysP13 devoid of CysR10. By immunoelectron microscopy, a more detailed structure of PB-I can be analyzed through its ultrastructure during different stages of seed development (at 5 DAF, 1 WAF, 2 WAF, and 3 WAF), then the Schematic images of PB-I structure during rice endosperm development can be obtained (Fig. 5). &amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177124&amp;oldid=prev</id>
		<title>Littlescrew: /* Labs working on this gene */</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0766100&amp;diff=177124&amp;oldid=prev"/>
				<updated>2014-06-04T05:53:17Z</updated>
		
		<summary type="html">&lt;p&gt;‎&lt;span dir=&quot;auto&quot;&gt;&lt;span class=&quot;autocomment&quot;&gt;Labs working on this gene&lt;/span&gt;&lt;/span&gt;&lt;/p&gt;
&lt;table class=&quot;diff diff-contentalign-left&quot; data-mw=&quot;interface&quot;&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;col class=&quot;diff-marker&quot; /&gt;
				&lt;col class=&quot;diff-content&quot; /&gt;
				&lt;tr style=&quot;vertical-align: top;&quot; lang=&quot;en&quot;&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;← Older revision&lt;/td&gt;
				&lt;td colspan=&quot;2&quot; style=&quot;background-color: white; color:black; text-align: center;&quot;&gt;Revision as of 05:53, 4 June 2014&lt;/td&gt;
				&lt;/tr&gt;&lt;tr&gt;&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot; id=&quot;mw-diff-left-l18&quot; &gt;Line 18:&lt;/td&gt;
&lt;td colspan=&quot;2&quot; class=&quot;diff-lineno&quot;&gt;Line 18:&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;==Labs working on this gene==&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;==Labs working on this gene==&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;−&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #ffe49c; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;del class=&quot;diffchange diffchange-inline&quot;&gt;Please input related labs here.&lt;/del&gt;&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins class=&quot;diffchange diffchange-inline&quot;&gt;1 Institute of Genetic Resources, Faculty of Agriculture, Kyushu University, Japan&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins class=&quot;diffchange diffchange-inline&quot;&gt;2 Organization for General Education, Yamaguchi Prefectural University, Japan&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins class=&quot;diffchange diffchange-inline&quot;&gt;3 Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Japan&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins class=&quot;diffchange diffchange-inline&quot;&gt;4 Institute of Biological Chemistry, Washington State University, USA&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&amp;#160;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td colspan=&quot;2&quot;&gt;&amp;#160;&lt;/td&gt;&lt;td class='diff-marker'&gt;+&lt;/td&gt;&lt;td style=&quot;color:black; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #a3d3ff; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;&lt;ins class=&quot;diffchange diffchange-inline&quot;&gt;5 Faculty of Life Science, Yamaguchi Prefectural University, Japan&lt;/ins&gt;&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;tr&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;==References==&lt;/div&gt;&lt;/td&gt;&lt;td class='diff-marker'&gt;&amp;#160;&lt;/td&gt;&lt;td style=&quot;background-color: #f9f9f9; color: #333333; font-size: 88%; border-style: solid; border-width: 1px 1px 1px 4px; border-radius: 0.33em; border-color: #e6e6e6; vertical-align: top; white-space: pre-wrap;&quot;&gt;&lt;div&gt;==References==&lt;/div&gt;&lt;/td&gt;&lt;/tr&gt;
&lt;/table&gt;</summary>
		<author><name>Littlescrew</name></author>	</entry>

	</feed>