Os03g0815100 - Revision history

Xysj2012: /* Structured Information */

2015-05-15T05:42:06Z

‎Structured Information

Zhangye at 15:46, 28 January 2015

2015-01-28T15:46:31Z

Zhangye: /* Genes related to SNAC1 */

2015-01-26T07:30:48Z

‎Genes related to SNAC1

Zhangye: /* Knowledge Extension */

2015-01-26T06:57:18Z

‎Knowledge Extension

Zhangye: /* Knowledge Extension */

2015-01-26T06:49:50Z

‎Knowledge Extension

Zhangye at 06:46, 26 January 2015

2015-01-26T06:46:01Z

124.16.129.48 at 19:45, 22 July 2012

2012-07-22T19:45:34Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os03g0815100| Description = Similar to OsNAC6 protein| Version = NM_001058217.1 GI:115456162 GeneID:4334553| Length = 1422 bp| Definition = Ory..."

2012-06-24T13:06:11Z

Created page with "{{JaponicaGene| GeneName = Os03g0815100| Description = Similar to OsNAC6 protein| Version = NM_001058217.1 GI:115456162 GeneID:4334553| Length = 1422 bp| Definition = Ory..."

New page

{{JaponicaGene|
GeneName = Os03g0815100|
Description = Similar to OsNAC6 protein|
Version = NM_001058217.1 GI:115456162 GeneID:4334553|
Length = 1422 bp|
Definition = Oryza sativa Japonica Group Os03g0815100, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
AP = Chromosome 3:35016833..35018254|
CDS = 35016912..35017385,35017515..35017991|
GCID = <gbrowseImage1>
name=NC_008396:35016833..35018254
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008396:35016833..35018254
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggggatggggatgaggagggagagggacgcggaggcggagctgaacctgccgccggggttcaggttccaccccacggacgacgagctggtggagcactacctgtgcaggaaggcggcggggcagcgcctgccggtgccgatcatcgccgaggtggatctctacaagttcgacccgtgggatctgcccgagcgcgcgctgttcggcgccagggagtggtacttcttcaccccgcgggatcgcaagtatcctaatgggtcacgccccaaccgcgccgccggcaacgggtactggaaggccaccggcgccgacaagcccgtcgcgccgcgggggcgcacgcttgggatcaagaaggcgctcgtgttctacgccggcaaggcgccgcgaggggtcaagactgattggatcatgcatgagtaccggctcgccgatgctggccgcgccgccgcgggcgccaagaagggatctctcaggttggatgattgggtgctgtgtcggctgtacaacaagaagaacgagtgggagaagatgcagcaggggaaggaggtgaaggaggaggcgtccgacatggttacgtcgcagtcgcactcgcacacccactcgtggggcgagacgcgcacgccggagtcggagatcgtggacaacgaccccttcccggagctggactcgttcccggcgttccagcctgcgccgccgccggcgacggcgatgatggtgcccaagaaagaatcgatggacgacgccaccgcggccgccgccgccgccgccaccatccccaggaacaacagcagcctgttcgtggacctgagctacgacgatatccagggcatgtacagcggcctcgacatgctgccgccgggcgacgacttctactcgtcgctcttcgcgtcgccgcgggtgaaggggacgacgccacgcgccggcgccggcatgggcatggtcccgttctga</cdnaseq>|
AA = <aaseq>MGMGMRRERDAEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRL PVPIIAEVDLYKFDPWDLPERALFGAREWYFFTPRDRKYPNGSRPNRAAGNGYWKATG ADKPVAPRGRTLGIKKALVFYAGKAPRGVKTDWIMHEYRLADAGRAAAGAKKGSLRLD DWVLCRLYNKKNEWEKMQQGKEVKEEASDMVTSQSHSHTHSWGETRTPESEIVDNDPF PELDSFPAFQPAPPPATAMMVPKKESMDDATAAAAAAATIPRNNSSLFVDLSYDDIQG MYSGLDMLPPGDDFYSSLFASPRVKGTTPRAGAGMGMVPF</aaseq>|
DNA = <dnaseqindica>80..553#683..1159#attcgagaaatccctcacaacccacaacattttcaaacaacgcaaagcagtagcagcagcgagaagcaagcaagaagcgatggggatggggatgaggagggagagggacgcggaggcggagctgaacctgccgccggggttcaggttccaccccacggacgacgagctggtggagcactacctgtgcaggaaggcggcggggcagcgcctgccggtgccgatcatcgccgaggtggatctctacaagttcgacccgtgggatctgcccgagcgcgcgctgttcggcgccagggagtggtacttcttcaccccgcgggatcgcaagtatcctaatgggtcacgccccaaccgcgccgccggcaacgggtactggaaggccaccggcgccgacaagcccgtcgcgccgcgggggcgcacgcttgggatcaagaaggcgctcgtgttctacgccggcaaggcgccgcgaggggtcaagactgattggatcatgcatgagtaccggctcgccgatgctggccgcgccgccgcgggcgccaagaagggatctctcagggtaagcttagctcagattcatccgaattactagcaatgatccttgcttcgatcgaagattattcggtgggagtgatgatcgataattggatcgtggtctgatctgatctggtgtgaattgtttgtgcagttggatgattgggtgctgtgtcggctgtacaacaagaagaacgagtgggagaagatgcagcaggggaaggaggtgaaggaggaggcgtccgacatggttacgtcgcagtcgcactcgcacacccactcgtggggcgagacgcgcacgccggagtcggagatcgtggacaacgaccccttcccggagctggactcgttcccggcgttccagcctgcgccgccgccggcgacggcgatgatggtgcccaagaaagaatcgatggacgacgccaccgcggccgccgccgccgccgccaccatccccaggaacaacagcagcctgttcgtggacctgagctacgacgatatccagggcatgtacagcggcctcgacatgctgccgccgggcgacgacttctactcgtcgctcttcgcgtcgccgcgggtgaaggggacgacgccacgcgccggcgccggcatgggcatggtcccgttctgaggtgacggcgacgcgatcgaacaggtggtgatcgatgctgcaacgtgtgtaaatatacagcgccggctgggtcaagagatggctcgggtgacgcgcgcgcggcgtgtcctggcgttggcgccggggcattctttagtttttcatcttttcatcatctcagatggtagatacaaaacagtgtatgtatgtagctctgtttctctctatagaaccccaacaaattttgttgttgatgttgtttatcttcatatgctttgatcttg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058217.1 RefSeq:Os03g0815100]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 3]]
[[Category:Chromosome 3]]

@@ Line 1: / Line 1: @@
-'''''SNAC1''''' ('''STRESS-RESPONSIVE NAC 1''') is a mumber of '''rice stress-responsive NAC family''' in rice.
+'''''SNAC1''''' ('''STRESS-RESPONSIVE NAC 1''') is a member of '''rice stress-responsive NAC family''' in rice.
 ==Annotated Information==
 ===Function===

@@ Line 20: / Line 20: @@
 ***''SNAC1'' can bind to the promoter of the ''OsPP18'' gene and '''activates''' its expression<ref name="ref3"/>.
-'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003677 GO:0003677], [http://amigo.geneontology.org/amigo/term/GO:0045449 GO:0045449]
+'''GO assignment(s):''' GO:0003677, GO:0045449
 ===Mutation===

@@ Line 66: / Line 66: @@
 *NAC family, which is one of the largest plant transcription factor families, is only found in plants to date<ref name="ref8"/>. Proteins of this family are characterized by a highly conserved DNA binding domain, known as NAC domain in the N-terminal region. In contrast, the C-terminal region of NAC proteins, usually containing the transcriptional activation domain, is highly diversified both in length and sequence<ref name="ref9"/>. More than 100 members of this family have been identified in both Arabidopsis and rice<ref name="ref10"/><ref name="ref9"/>. However, only a few of them have been functionally characterized, especially in rice. NACs play important roles in plant development, including pattern formation of embryos and flowers, formation of secondary walls, and development of lateral roots. NACs are also reported to participate in abiotic and biotic responses.
-*Genetic improvement in drought tolerance in rice is the key to save water for sustainable agriculture. Drought tolerance is a complex trait and involves interplay of a vast array of genes. Several genotypes of rice have evolved features that impart tolerance
+*Genetic improvement in drought tolerance in rice is the key to save water for sustainable agriculture. Drought tolerance is a complex trait and involves interplay of a vast array of genes. Several genotypes of rice have evolved features that impart tolerance to drought and other abiotic stresses<ref name="ref11"/>.
 ==Labs working on this gene==

@@ Line 57: / Line 57: @@
 ===Knowledge Extension===
 [[File: OsNACs Amodel1.jpg|right|thumb|300px|'''Figure 1.''' ''A model of a transcriptional cascade of OsNACs under abiotic stress condition in rice(from reference <ref name="ref5"/>).'']]
-*The '''rice stress-responsive NAC family''' includes '''five''' members: '''''OsNAC3''''', '''''OsNAC4''''', '''''OsNAC5''''', '''''OsNAC6''''', and '''''SNAC1'''''. Their expression was induced by abiotic stresses such as drought and high salinity. ''OsNAC5''' and ''OsNAC6'' are strongly induced by ABA and ''SNAC1'' is also transiently induced by ABA. Three ABA-responsive elements (ABREs; ACGTG G/TC; red bars) exist in the ''OsNAC5'' and ''OsNAC6'' promoters. All of these genes are induced by JA and JA may mediate both abiotic and biotic stress signaling. Unknown factorsmaymediate abiotic stress signaling as shown with the dashed arrows. Overexpression of ''OsNAC5'', ''OsNAC6'', and ''SNAC1'' are capable of enhancing stress tolerance. Although ''OsNAC5'' is suggested to be a senescence-associated TF, the functions of the other OsNACs in relation to senescence are not well characterized<ref name="ref5"/>.
+*The '''rice stress-responsive NAC family''' includes '''five''' members: '''''OsNAC3''''', '''''OsNAC4''''', '''''OsNAC5''''', '''''OsNAC6''''', and '''''SNAC1'''''. Their expression was induced by abiotic stresses such as drought and high salinity. ''OsNAC5'' and ''OsNAC6'' are strongly induced by ABA and ''SNAC1'' is also transiently induced by ABA. Three ABA-responsive elements (ABREs; ACGTG G/TC; red bars) exist in the ''OsNAC5'' and ''OsNAC6'' promoters. All of these genes are induced by JA and JA may mediate both abiotic and biotic stress signaling. Unknown factorsmaymediate abiotic stress signaling as shown with the dashed arrows. Overexpression of ''OsNAC5'', ''OsNAC6'', and ''SNAC1'' are capable of enhancing stress tolerance. Although ''OsNAC5'' is suggested to be a senescence-associated TF, the functions of the other OsNACs in relation to senescence are not well characterized<ref name="ref5"/>.
 *Some NAC genes outside of the SNAC group also show response to abiotic stress in rice<ref name="ref6"/>. The rice [[Os11g0127600|''ONAC045'']] gene in the NAC group NAM/CUC3 was induced by drought, high-salt, low temperature stress and in response to ABA treatment<ref name="ref5"/>.

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+'''''SNAC1''''' ('''STRESS-RESPONSIVE NAC 1''') is a mumber of '''rice stress-responsive NAC family''' in rice.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*The transgenic rice also shows significantly '''improved drought resistance''' and '''salt tolerance''' at the '''vegetative stage'''. ''SNAC1'' is induced predominantly in '''guard cells''' by drought and '''encodes''' a NAM, ATAF, and CUC('''NAC''') '''transcription factor''' with transactivation activity. DNA chip analysis revealed that a large number of '''stress-related genes''' were '''up-regulated''' in the SNAC1 overexpressing rice plants. Thus, ''SNAC1'' holds promising utility in improving drought and salinity tolerance in rice<ref name="ref1"/>. This gene may show great promise for the genetic improvement of stress tolerance in '''cotton'''<ref name="ref2"/>.
 ===Expression===
-Please input expression information here.
+*The ''SNAC1'' gene is induced by drought predominantly in guard cells, and the GFP signal was observed for guard cells on both the upper and lower sides of '''leaves'''. Northern blot analysis revealed that the expression of this gene could be '''induced by drought''', '''salt''', '''cold''', and '''abscisic acid'''<ref name="ref1"/>.
 ===Evolution===
-Please input evolution information here.
+*''SNAC1'' showed '''98.6% sequence identity''' and the '''same location''' in the rice genome to the predicted gene '''ONAC044'''<ref name="ref1"/>.
-You can also add sub-section(s) at will.
+*NAC family, which is one of the largest plant transcription factor families, is only found in plants to date<ref name="ref8"/>. Proteins of this family are characterized by a highly conserved DNA binding domain, known as NAC domain in the N-terminal region. In contrast, the C-terminal region of NAC proteins, usually containing the transcriptional activation domain, is highly diversified both in length and sequence<ref name="ref9"/>. More than 100 members of this family have been identified in both Arabidopsis and rice<ref name="ref10"/><ref name="ref9"/>. However, only a few of them have been functionally characterized, especially in rice. NACs play important roles in plant development, including pattern formation of embryos and flowers, formation of secondary walls, and development of lateral roots. NACs are also reported to participate in abiotic and biotic responses.
 ==Labs working on this gene==
-Please input related labs here.
+*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan) and College of Life Science and Technology, Huazhong Agricultural University, Wuhan 430070, China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

@@ Line 110: / Line 110: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

← Older revision		Revision as of 19:45, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os03g0815100\|		GeneName = Os03g0815100\|