Os03g0820300 - Revision history

Xysj2012: /* Structured Information */

2015-05-15T05:41:43Z

‎Structured Information

Zhangye: /* Evolution */

2014-12-31T00:33:01Z

‎Evolution

Zhangye at 04:35, 30 December 2014

2014-12-30T04:35:20Z

124.16.129.48 at 19:45, 22 July 2012

2012-07-22T19:45:47Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os03g0820300| Description = Similar to ZPT2-14| Version = NM_001058253.1 GI:115456234 GeneID:4334592| Length = 851 bp| Definition = Oryza sativ..."

2012-06-24T13:06:51Z

Created page with "{{JaponicaGene| GeneName = Os03g0820300| Description = Similar to ZPT2-14| Version = NM_001058253.1 GI:115456234 GeneID:4334592| Length = 851 bp| Definition = Oryza sativ..."

New page

{{JaponicaGene|
GeneName = Os03g0820300|
Description = Similar to ZPT2-14|
Version = NM_001058253.1 GI:115456234 GeneID:4334592|
Length = 851 bp|
Definition = Oryza sativa Japonica Group Os03g0820300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
AP = Chromosome 3:35274913..35275763|
CDS = 35274991..35275503|
GCID = <gbrowseImage1>
name=NC_008396:35274913..35275763
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008396:35274913..35275763
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgaagcacccgaggcaggaggaggaggtgtcgctggcgctggcgctgagcacggactgctcgtcgacggcgtcggactcgtcggcggcggcggcgggcggcgcggcgaggaggaagagggcgcggcggaggagcgtggtggcgacgtcgggggaaggggagttcgtgtgcaagacttgcagccgcgcgttcccgaccttccaggcgctcgggggccaccggaccagccacctccgcggccggagcaacgggctcgacctcggcgccatcggcgacaaggcgatcaggctgcacagggcggccgacaaggagcacagggacaagcacgagtgccacatctgcggcctcggcttcgagatgggccaggcgctcggcggacacatgcggcgccaccgcgaggagatggccgccgccggcggtggatcctccgccgacgactgggtctggcgctgcgacgcgcggccggaggggatcgccgccgagccaccggtgttgctggagttgttcgcctag</cdnaseq>|
AA = <aaseq>MKHPRQEEEVSLALALSTDCSSTASDSSAAAAGGAARRKRARRR SVVATSGEGEFVCKTCSRAFPTFQALGGHRTSHLRGRSNGLDLGAIGDKAIRLHRAAD KEHRDKHECHICGLGFEMGQALGGHMRRHREEMAAAGGGSSADDWVWRCDARPEGIAA EPPVLLELFA</aaseq>|
DNA = <dnaseqindica>79..591#atccatcgatctccccccaaccaaaaatctctctctcaatccatcgatccattaattcacaagcttatcgaatcggagatgaagcacccgaggcaggaggaggaggtgtcgctggcgctggcgctgagcacggactgctcgtcgacggcgtcggactcgtcggcggcggcggcgggcggcgcggcgaggaggaagagggcgcggcggaggagcgtggtggcgacgtcgggggaaggggagttcgtgtgcaagacttgcagccgcgcgttcccgaccttccaggcgctcgggggccaccggaccagccacctccgcggccggagcaacgggctcgacctcggcgccatcggcgacaaggcgatcaggctgcacagggcggccgacaaggagcacagggacaagcacgagtgccacatctgcggcctcggcttcgagatgggccaggcgctcggcggacacatgcggcgccaccgcgaggagatggccgccgccggcggtggatcctccgccgacgactgggtctggcgctgcgacgcgcggccggaggggatcgccgccgagccaccggtgttgctggagttgttcgcctagttaccgctggtctccattagtttcgtccaagttttgaactgacgcagtgtgtgtcaccattaattagttcatgtacatgtctagaaaaaaaaagtcaggttcatcgatcttgtaactatgataggggtttaattttttttttcattagcgtttgggttgttcggttttgaatcggtcagtttttgaaccgtttggtggagatttgttgagttcagatgtatatacacacacagatgtaatataattctttcattcatagc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001058253.1 RefSeq:Os03g0820300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 3]]
[[Category:Chromosome 3]]

@@ Line 29: / Line 29: @@
 ===Evolution===
-[[File: ZFP182 phylogenetic tree.jpg|right|thumb|280px|'''Figure 4.''' The phylogenetic tree of plant stress-responsive C2H2-type zinc finger proteins.(from reference <ref name="ref2"/>).'']]
+[[File: ZFP182 phylogenetic tree.jpg|right|thumb|280px|'''Figure 4.''' The phylogenetic tree of plant stress-responsive C2H2-type zinc finger proteins.(from reference <ref name="ref2"/>.'']]
-*A phylogenetic tree was constructed using neighbor-joining method with the full-length amino acid sequences To investigate the evolutionary relationship among plant C<sub>2</sub>H<sub>2</sub>-type zinc finger proteins involved in stress responses, (Fig. 4). The result revealed that ''ZFP182'' was clustered with ''ZAT12'', an ''Arabidopsis'' stress responsive zinc finger protein<ref name="ref2"/><ref name="ref4"/>), whereas other stress responsive zinc finger proteins were categorized into another big branch.
+*A phylogenetic tree was constructed using neighbor-joining method with the full-length amino acid sequences To investigate the evolutionary relationship among plant C<sub>2</sub>H<sub>2</sub>-type zinc finger proteins involved in stress responses, (Fig. 4). The result revealed that ''ZFP182'' was clustered with ''ZAT12'', an ''Arabidopsis'' stress responsive zinc finger protein<ref name="ref2"/><ref name="ref4"/>, whereas other stress responsive zinc finger proteins were categorized into another big branch.
-*To investigate the evolutionary relationship among plant C<sub>2</sub>H<sub>2</sub>-type zinc finger proteins involved in stress responses, a phylogenetic tree was constructed using Neighbor–Joining method with the full-length amino acid sequences (Fig. 1B).<ref name="ref5"/>).The result revealed that ''ZFP179'' was clustered with ''ZFP182'', ''ZFP150'', and ''ZAT12'', whereas other stress responsive zinc finger proteins were categorized into another big branch.
+*To investigate the evolutionary relationship among plant C<sub>2</sub>H<sub>2</sub>-type zinc finger proteins involved in stress responses, a phylogenetic tree was constructed using Neighbor–Joining method with the full-length amino acid sequences (Fig. 1B).<ref name="ref5"/>.The result revealed that ''ZFP179'' was clustered with ''ZFP182'', ''ZFP150'', and ''ZAT12'', whereas other stress responsive zinc finger proteins were categorized into another big branch.
 ===Subcellular Localization===

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+As an ABA- and H<sub>2</sub>O<sub>2</sub>-responsive C<sub>2</sub>H<sub>2</sub>-type ZFP gene, the rice ''ZFP182'' enhanced multiple abiotic stress tolerances, including salt, cold and drought tolerances in transgenic rice<ref name="ref1"/><ref name="ref2"/><ref name="ref3"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*ABA treatment induced the increases in the expression of ''ZFP182'', ''OsMPK1'' and ''OsMPK5'', and the activities of superoxide dismutase (SOD) and ascorbate peroxidase (APX) in rice leaves. The transient gene expression analysis and the transient RNA interference (RNAi) analysis in protoplasts showed that ''ZFP182'', ''OsMPK1'' and ''OsMPK5'' are involved in ABA-induced up-regulation in the activities of SOD and APX. Besides, ''OsMPK1'' and ''OsMPK5'' were shown to be required for the up-regulation in the expression of ''ZFP182'' in ABA signaling, but ZFP182 did not mediate the ABA-induced up-regulation in the expression of ''OsMPK1'' and ''OsMPK5'', which indicate that ''ZFP182'' is required for ABA-induced antioxidant defense and the expression of ''ZFP182'' is regulated by rice MAPKs in ABA signaling<ref name="ref1"/>.
 ===Expression===
-Please input expression information here.
+[[File: ZFP182 expression1.jpg|left|thumb|330px|'''Figure 1.''' ''Overexpression of ZFP182 in rice confers tolerance to salt stress.(from reference <ref name="ref3"/>).'']]
 ===Evolution===
-Please input evolution information here.
+[[File: ZFP182 phylogenetic tree.jpg|right|thumb|280px|'''Figure 4.''' The phylogenetic tree of plant stress-responsive C2H2-type zinc finger proteins.(from reference <ref name="ref2"/>).'']]
-You can also add sub-section(s) at will.
+===Knowledge Extension===
 ==Labs working on this gene==
-Please input related labs here.
+*College of Life Sciences, Nanjing Agricultural University, Nanjing 210095, China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 19:45, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os03g0820300\|		GeneName = Os03g0820300\|

@@ Line 70: / Line 70: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]