Os04g0463400 - Revision history

Xysj2027 at 11:04, 7 May 2017

2017-05-07T11:04:32Z

192.168.72.52: /* Structured Information */

2015-06-12T07:04:25Z

‎Structured Information

Littlescrew: /* References */

2014-06-06T10:27:37Z

‎References

Littlescrew: /* Labs working on this gene */

2014-06-06T10:26:30Z

‎Labs working on this gene

Littlescrew: /* Expression */

2014-06-06T10:25:21Z

‎Expression

Littlescrew: /* Expression */

2014-06-06T10:24:02Z

‎Expression

Littlescrew: /* Function */

2014-06-06T10:20:39Z

‎Function

124.16.129.48 at 19:54, 22 July 2012

2012-07-22T19:54:13Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os04g0463400| Description = Protein of unknown function DUF125, transmembrane family protein| Version = NM_001059545.1 GI:115458819 GeneID:433607..."

2012-06-24T11:13:15Z

Created page with "{{JaponicaGene| GeneName = Os04g0463400| Description = Protein of unknown function DUF125, transmembrane family protein| Version = NM_001059545.1 GI:115458819 GeneID:433607..."

New page

{{JaponicaGene|
GeneName = Os04g0463400|
Description = Protein of unknown function DUF125, transmembrane family protein|
Version = NM_001059545.1 GI:115458819 GeneID:4336075|
Length = 2850 bp|
Definition = Oryza sativa Japonica Group Os04g0463400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:23532796..23535645|
CDS = 23532960..23533260,23533526..23533640,23533773..23533858,23535286..23535542|
GCID = <gbrowseImage1>
name=NC_008397:23532796..23535645
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:23532796..23535645
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcggcggcgacggacggcggggggctgccgctgctggcggacaaggcggcgagccacagccaccaccaccacccggagcggcacttcacgtcgggggaggtggtccgcgacgtcatcatgggcgtctccgacggcctcaccgtgcccttcgccctcgccgcggggctctccggcgccagcgcgccatcctcgctcgtgctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtatctcgcggccaagagcgaggcagaccattaccagcgggagatgaaaagggagcaggaggagatcatcgccgtcccggacactgaggctgctgagattggcgagatcatgtcgcagtacgggctcgaaccgcatgagtatggccctgtcgtggacgggctccgtaggaatcctcaagcttggctcgacttcatgatgaggtttgagctgggattggagaaaccagaccctaaaagagctatacagagcgctttaacaattgcgctatcttatgtcattggtggactggtccctctccttccctacatgtttatctccacagcacagaacgccatgctcacatctgtcggtgtcacgctggttgcactacttttctttggatacatcaagggtcgctttactggaaaccgtccattcctcagcgctgtccaaactgctattatcggtgcgcttgcttctgctgcggcatatggaatggccaaggccgtgcaaactagatga</cdnaseq>|
AA = <aaseq>MAAATDGGGLPLLADKAASHSHHHHPERHFTSGEVVRDVIMGVS DGLTVPFALAAGLSGASAPSSLVLTAGLAEVAAGAISMGLGGYLAAKSEADHYQREMK REQEEIIAVPDTEAAEIGEIMSQYGLEPHEYGPVVDGLRRNPQAWLDFMMRFELGLEK PDPKRAIQSALTIALSYVIGGLVPLLPYMFISTAQNAMLTSVGVTLVALLFFGYIKGR FTGNRPFLSAVQTAIIGALASAAAYGMAKAVQTR</aaseq>|
DNA = <dnaseqindica>2386..2686#2006..2120#1788..1873#104..360#aaataaaccacctcttcaaacgtgcgtcgcctgaccgcttccatccatccaccagtctcgcttcttcgtgtctacggtctacctcggcgagtcggcggcggcgatggcggcggcgacggacggcggggggctgccgctgctggcggacaaggcggcgagccacagccaccaccaccacccggagcggcacttcacgtcgggggaggtggtccgcgacgtcatcatgggcgtctccgacggcctcaccgtgcccttcgccctcgccgcggggctctccggcgccagcgcgccatcctcgctcgtgctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtaaacattaaacactcatcatctctctgtgtgttccttgtccatgcattgcacccctgaatccctgattaatctagcgaagttagcaatatgtcagtttcgtcgtatagatttgctcttcttttcttttttttttaaagaggggttccgagtttttcattaccaaaacaggaaacccagcggcagggtgcagtagtatgtcagtgaatacaatagaaagctttcggggacccacaggccacagcccataacatgatactagtaatttattaatcacctgaaatcggaatgtactgcagtatgatcatgatgaaacaaaaaattttgatacgccatgcacgcatatatttgctcgtacaattatcgggttccgtcttttgcagagacgcttaacacgtgtctgcgagaataggaaacaattcatacgattggtttgtccaatgatttttacaagatcctatgaaatcataaataatgatttataaaaaaatcctatggaatttctttcaaacaaaaggatctcttaagatgagatgaagattaagtttttcacgcaaaacttttggtattaacatataattgattgagttttaattattacaaacttgaaaaatagattaatatgatattttagagcaagtttcctatagaaagttttcacacgaaacgtacgttaagcaatttgaaaaacgtgccaaaaaattttaatgttcatccaactcttgttggagaaaagaacgagattgtctacggtttttttccctacagcctagaatattttccacgaccttgtagaacaggggagatgtggacaaggcataagcagtacagagtggagactgactggagagatggttgtaaatcgtattaggcgctcgcgcttaaaacatattacttgctgaatataagaagtggagtaatggattaataaaaaaaatggccagcaagcaagttaccgtgctcttggctgttttaatgggagttaggtatgcctgcctgaatatactcacagattcacaggtgtacttgctgaatattgccttgttacctcatgaaaaatcaattaggaaagcccatagtgttcgttgctctgcagattgtgcacggcgtatctgaccttctctgttctttgcctagctcccacccctacagtcccagttgcagattactcctgtcatccaaagcccgaaaaaggagtaattaaagtaaagttagctcgtgatggacacgtgtgtggccctataccacgtgctgttccagcacactttgtgttagtgtcacaacttttaggcctaagaaagtggagaataatactttcccccctttaaactgggaacaagacaagatcacattgttttcaaatcgaaaaaaggcgcgcgcaattgcacaaacgcatgacacttacccgcaattgcaccatgtggtaggtatctcgcggccaagagcgaggcagaccattaccagcgggagatgaaaagggagcaggaggagatcatcgccgtcccggacactggtaagccgataagcagatacaacaagataccatatgctgagacatgtcgctaagattcctcccatctgcgaccagcaggaaagctgcctcactttgtttaaaaaacttttggtttcctggttgatcgatcagaggctgctgagattggcgagatcatgtcgcagtacgggctcgaaccgcatgagtatggccctgtcgtggacgggctccgtaggaatcctcaagcttggctcgacttcatgatgaggtaatatgaccaactgttgctactccctttgtcaatctcttcatcagttatactagaaagcaaatgttgatgtcctgatggtgtctgagatactaatcagaaatgtttcgattatcctgtatgcgtttgccatagctcatataagaagctttcaacaatgaaaaccacacatatattagtaaacagcaagatttcaatcatataaaatataaaaattgatttggaattatcaaaccaacttaactaaccagagcaatgtatgcaggtttgagctgggattggagaaaccagaccctaaaagagctatacagagcgctttaacaattgcgctatcttatgtcattggtggactggtccctctccttccctacatgtttatctccacagcacagaacgccatgctcacatctgtcggtgtcacgctggttgcactacttttctttggatacatcaagggtcgctttactggaaaccgtccattcctcagcgctgtccaaactgctattatcggtgcgcttgcttctgctgcggcatatggaatggccaaggccgtgcaaactagatgatttgaaccctcatgtgttcctgtctgaagtttcagtaggcagaactgaatccaacgaagctgcaatgaatcacaatctcatattaagaatatgtattttacctttcatgtaacaaggaataaattttgggaaacatgaaataaaagcatgctattttaagttct</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059545.1 RefSeq:Os04g0463400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os04g0463400''''' was reported as '''''OsVIT1''''' in 2012 by researchers from China.
 ==Annotated Information==
 ===Function===
-OsVIT1 and OsVIT2 may function primarily in flag leaves to mediate vacuolar sequestration of Fe and Zn, due to highly expression levels of ''OsVIT1'' and ''OsVIT2'' in flag leaves rather than embryos. And they might also mediate allocation of Fe/Zn between flag leaves and the grains<ref name="ref1" />. Knockdown of the vacuolar Fe transporter gene OsVIT1 or OsVIT2 may be useful to further increase the Fe concentration of seeds <ref name="ref2" />.
+[[File:OsVIT2.jpg|right|thumb|327px|'''Figure 1.'''Subcellular localization of OsVIT1 and OsVIT2<ref name="ref1" />.]]
 ===Expression===
-''OsVIT2'' locates in chromosome 4 with four exons and three introns as predicted, and encodes putative protein as the vacuolar iron transporter with 252 amino acids which shares 80.6% amino acid similarity with the VIT in ''Arabidopsis''. There are five conserved transmembrane domains in OsVIT1 by further analyses. This gene expresses in flag leaf blades with a significantly high level<ref name="ref1" />. different from ''OsVIT2'' was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, ''OsVIT1'' was not highly induced. Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels<ref name="ref1" />.
+* This gene expresses in flag leaf sheaths with a significantly high level, but it can also be detected in various tissues/organs including embryos at low levels.
 ===Subcellular localization===
+* OsVIT1 and OsVIT2 were localized to vacuolar membrane<ref name="ref1" /> when they combined with enhanced green fluorescent protein and expressed(Figure 1).
 ===Evolution===
-Please input evolution information here.
+* ''OsVIT2'' locates in chromosome 9, and encodes putative protein as the vacuolar iron transporter with 247 amino acids which shares 79.8% amino acid similarity with the VIT in ''Arabidopsis''.
 You can also add sub-section(s) at will.

@@ Line 23: / Line 23: @@
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

@@ Line 19: / Line 19: @@
 ==Labs working on this gene==
-Please input related labs here.
+*National Key Laboratory of Plant Molecular Genetics and National Center for Plant Gene Research (Shanghai), Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, China
 ==References==

@@ Line 7: / Line 7: @@
 ===Expression===
 ''OsVIT2'' locates in chromosome 4 with four exons and three introns as predicted, and encodes putative protein as the vacuolar iron transporter with 252 amino acids which shares 80.6% amino acid similarity with the VIT in ''Arabidopsis''. There are five conserved transmembrane domains in OsVIT1 by further analyses. This gene expresses in flag leaf blades with a significantly high level<ref name="ref1" />. different from ''OsVIT2'' was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, ''OsVIT1'' was not highly induced. Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels<ref name="ref1" />.
 ===Evolution===

@@ Line 6: / Line 6: @@
 ===Expression===
-Please input expression information here.
+''OsVIT2'' locates in chromosome 4 with four exons and three introns as predicted, and encodes putative protein as the vacuolar iron transporter with 252 amino acids which shares 80.6% amino acid similarity with the VIT in ''Arabidopsis''. There are five conserved transmembrane domains in OsVIT1 by further analyses. This gene expresses in flag leaf blades with a significantly high level<ref name="ref1" />. different from ''OsVIT2'' was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, ''OsVIT1'' was not highly induced. Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels<ref name="ref1" />.
 ===Evolution===

@@ Line 29: / Line 29: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

← Older revision		Revision as of 19:54, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os04g0463400\|		GeneName = Os04g0463400\|