Os05g0119000 - Revision history

192.168.72.52: /* Structured Information */

2015-06-12T07:27:53Z

‎Structured Information

YunXX at 12:22, 4 June 2014

2014-06-04T12:22:27Z

YunXX at 12:20, 4 June 2014

2014-06-04T12:20:30Z

124.16.129.48 at 20:03, 22 July 2012

2012-07-22T20:03:22Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os05g0119000| Description = Conserved hypothetical protein 245 family protein| Version = NM_001061014.1 GI:115461758 GeneID:4337635| Length = 11..."

2012-06-24T10:04:27Z

Created page with "{{JaponicaGene| GeneName = Os05g0119000| Description = Conserved hypothetical protein 245 family protein| Version = NM_001061014.1 GI:115461758 GeneID:4337635| Length = 11..."

New page

{{JaponicaGene|
GeneName = Os05g0119000|
Description = Conserved hypothetical protein 245 family protein|
Version = NM_001061014.1 GI:115461758 GeneID:4337635|
Length = 1139 bp|
Definition = Oryza sativa Japonica Group Os05g0119000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
AP = Chromosome 5:967668..968806|
CDS = 967774..968631|
GCID = <gbrowseImage1>
name=NC_008398:967668..968806
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008398:967668..968806
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatggcgagcatggcggcgctgctgcagcgtctgctggtggtggtgaatcaggtggacccgggcgcgccggggttctggcgggagttcttggtgggcatgctgaagccggtggcggcgacggcggtggtggcgatggcggtggcgctgagcttcacgcagcggctggggctcgagggcgagatgctgtacgccatggcgcgggcgttcctccagctctccgtcatcggcttcgtcctccagttcatcttcacccagaagagcgccgcctggatcctcctcgcctacctcttcatggtcaccgtcgccggctacaccgcggggcagcgcgcccgccacgtcccgcgggggaagcacatcgccgccgtctccatcctcgccggcacctccgtcaccatggccctcctcgtggcgctccgggtgttcccgttcacgccgcggtacatcatcccggtggccgggatgatggtcgggaacgcgatgacggtgaccggggtgacgatgaagaagctgagggaggacgtggggatgcagcgaggggtggtggagacggcgctggcgctgggcgcgacgccgcggcaggcgacggcgcggcaggtgaggaggtcgctggtgatcgcgctgtcgccggtgatcgacaacgccaagacggtggggctgatcgcgctgccgggcgccatgaccggcctcatcatgggcggcgcgtcgccgctggaggccatccagctgcagatcgtggtgatgaacatgctcatgggcgcttccaccgtcagcagcatcctctccacctacctctgctggccggccttcttcaccggcgccttccagctcaacgacgccgtcttcgccgccgactaa</cdnaseq>|
AA = <aaseq>MMASMAALLQRLLVVVNQVDPGAPGFWREFLVGMLKPVAATAVV AMAVALSFTQRLGLEGEMLYAMARAFLQLSVIGFVLQFIFTQKSAAWILLAYLFMVTV AGYTAGQRARHVPRGKHIAAVSILAGTSVTMALLVALRVFPFTPRYIIPVAGMMVGNA MTVTGVTMKKLREDVGMQRGVVETALALGATPRQATARQVRRSLVIALSPVIDNAKTV GLIALPGAMTGLIMGGASPLEAIQLQIVVMNMLMGASTVSSILSTYLCWPAFFTGAFQ LNDAVFAAD</aaseq>|
DNA = <dnaseqindica>107..964#gtcgcctccctcgctcgccgcctcccccgcttccgctcgctcaccaccaccaactcctcctcgtcttcatcaacgcgctcggtcgcctcgcctcgctctggaacgcatgatggcgagcatggcggcgctgctgcagcgtctgctggtggtggtgaatcaggtggacccgggcgcgccggggttctggcgggagttcttggtgggcatgctgaagccggtggcggcgacggcggtggtggcgatggcggtggcgctgagcttcacgcagcggctggggctcgagggcgagatgctgtacgccatggcgcgggcgttcctccagctctccgtcatcggcttcgtcctccagttcatcttcacccagaagagcgccgcctggatcctcctcgcctacctcttcatggtcaccgtcgccggctacaccgcggggcagcgcgcccgccacgtcccgcgggggaagcacatcgccgccgtctccatcctcgccggcacctccgtcaccatggccctcctcgtggcgctccgggtgttcccgttcacgccgcggtacatcatcccggtggccgggatgatggtcgggaacgcgatgacggtgaccggggtgacgatgaagaagctgagggaggacgtggggatgcagcgaggggtggtggagacggcgctggcgctgggcgcgacgccgcggcaggcgacggcgcggcaggtgaggaggtcgctggtgatcgcgctgtcgccggtgatcgacaacgccaagacggtggggctgatcgcgctgccgggcgccatgaccggcctcatcatgggcggcgcgtcgccgctggaggccatccagctgcagatcgtggtgatgaacatgctcatgggcgcttccaccgtcagcagcatcctctccacctacctctgctggccggccttcttcaccggcgccttccagctcaacgacgccgtcttcgccgccgactaatcttccctcttccacaacaccttgcattttgattcattatggattactgcttagtgattagtagtagtagtaattagttgttgagtacttacttagtaggacgagagagaaagtaagagtgtgtatgtcttgaggttaatttcttcttccataataaatcatgtgttgatgactt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061014.1 RefSeq:Os05g0119000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]

@@ Line 12: / Line 12: @@
 ===Evolution===
-[[File:X_3.jpg|right|thumb|150px|Alignment of STAR2 and ALS3.]]
+[[File:X_3.jpg|left|thumb|150px|Alignment of STAR2 and ALS3.]]
 STAR2 is a homolog of ALS3, which is involved in Al tolerance in Arabidopsis<ref name="ref2" />. However, STAR2 and ALS3 differ in expression pattern and cellular localization. STAR2 is only expressed in the roots, whereas ALS3 is expressed in all organs, including roots, leaves, stems, and flowers <ref name="ref2" />.The expression of both STAR2 and ALS3 is induced by Al<ref name="ref2" />. In the roots exposed to Al, ALS3 is localized in the phloem and root tips. By contrast, STAR2 is localized in all cells excepting epidermal cells in the mature root zone.
 ==Labs working on this gene==
@@ Line 20: / Line 20: @@
 ==References==
 <ref name="ref1">Chao Feng Huang, Naoki Yamaji, Namiki Mitani, et.al. (2009) A Bacterial-Type ABC Transporter Is Involved in Aluminum Tolerance in Rice. The Plant Cell, Vol. 21: 655-667.</ref>
 <ref  name="ref2">Larsen, P.B., Geisler, M.J.B., Jones, C.A., Williams, K.M., and Cancel, J.D.(2005). ALS3encodes a phloem-localized ABC transporter-like protein that is required for aluminum tolerance inArabidopsis.Plant J.41:353–363.</ref>
 ==Structured Information==

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+Os05g0119000 is the gene STAR2 which is responsible for Al tolerance in rice, and it encodes a transmembrane domain, of a bacterial-type ATP binding cassette (ABC) transporter.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+[[File:X_1.jpg|left|thumb|150px|Phylogenetic Relationship and Knockdown Assay of STAR2.]]
 ===Expression===
-Please input expression information here.
+[[File:X_2.jpg|right|thumb|150px|Expression Analysis ofSTAR1andSTAR2.]]
 ===Evolution===
-Please input evolution information here.
+[[File:X_3.jpg|right|thumb|150px|Alignment of STAR2 and ALS3.]]
+STAR2 is a homolog of ALS3, which is involved in Al tolerance in Arabidopsis<ref name="ref2" />. However, STAR2 and ALS3 differ in expression pattern and cellular localization. STAR2 is only expressed in the roots, whereas ALS3 is expressed in all organs, including roots, leaves, stems, and flowers <ref name="ref2" />.The expression of both STAR2 and ALS3 is induced by Al<ref name="ref2" />. In the roots exposed to Al, ALS3 is localized in the phloem and root tips. By contrast, STAR2 is localized in all cells excepting epidermal cells in the mature root zone.
 ==Labs working on this gene==
-Please input related labs here.
+·Research Institute for Bioresources, Okayama University, Kurashiki 710-0046, Japan.
 ==References==
-Please input cited references here.
+<ref name="ref1">Chao Feng Huang, Naoki Yamaji, Namiki Mitani, et.al. (2009) A Bacterial-Type ABC Transporter Is Involved in Aluminum Tolerance in Rice. The Plant Cell, Vol. 21: 655-667.</ref>
 ==Structured Information==

← Older revision		Revision as of 20:03, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os05g0119000\|		GeneName = Os05g0119000\|

@@ Line 26: / Line 26: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]