Os05g0138300 - Revision history

192.168.72.52: /* Structured Information */

2015-06-12T07:29:20Z

‎Structured Information

Zhangye at 13:06, 22 March 2015

2015-03-22T13:06:46Z

124.16.129.48 at 20:04, 22 July 2012

2012-07-22T20:04:03Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os05g0138300| Description = Hydrophobic protein LTI6B (Low temperature-induced protein 6B)| Version = NM_001061126.1 GI:115461982 GeneID:4337750|..."

2012-06-24T10:06:08Z

Created page with "{{JaponicaGene| GeneName = Os05g0138300| Description = Hydrophobic protein LTI6B (Low temperature-induced protein 6B)| Version = NM_001061126.1 GI:115461982 GeneID:4337750|..."

New page

{{JaponicaGene|
GeneName = Os05g0138300|
Description = Hydrophobic protein LTI6B (Low temperature-induced protein 6B)|
Version = NM_001061126.1 GI:115461982 GeneID:4337750|
Length = 865 bp|
Definition = Oryza sativa Japonica Group Os05g0138300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
AP = Chromosome 5:2197781..2198645|
CDS = 2198224..2198307,2198424..2198507|
GCID = <gbrowseImage1>
name=NC_008398:2197781..2198645
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008398:2197781..2198645
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgggaacggcgaactgcatcgacatcctcatcgccatcatcctcccgcccctcggcgtcttcctcaagttcggatgcgggcatgagttctggatctgcctgttgctcaccttcctcggctacatccccggcatcatctacgccatctacgccatcaccaagtaa</cdnaseq>|
AA = <aaseq>MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIP GIIYAIYAITK</aaseq>|
DNA = <dnaseqindica>339..422#139..222#gttcagagttgcccactgctactttactttgcagctattttgcttctgcttcttcttgttcttgttgctgttggtaatactgcgagagaaattaatcagtagagtgttcatctactatcaatttttgatcgaggagagatggcgggaacggcgaactgcatcgacatcctcatcgccatcatcctcccgcccctcggcgtcttcctcaagttcggatgcggggtaattatggagtacctaattaaattactctctgttaccttagtttcttccatgccttttgcttaatttggtcgatcgatttgctcttgctaattaacttgcacatatatatgcagcatgagttctggatctgcctgttgctcaccttcctcggctacatccccggcatcatctacgccatctacgccatcaccaagtaattcatcattagttactacatcatcaaccaaatcctcaaggtgaagtagtgaaatcgaattccctaatctacctcctcctagctaattcatcaaaacttcacttaatatttttccacacatatcaatctaaagtttcctttgttttctggatgtatgtatgcagggatgggctccaaaccgcttcatctatcttctcgattgccgtgtgcttgttggaatttggaaatgatatatgcatccaaaattcagtcctgagtgctccaattcttgtcatctagtcattttcaatgtccccccagtctcttcctctaatgtttgatgatatgtagaatctcttgctgttaatctgttgctttcgtgtgaataagctcccctcttatgtatatctatctatgacttgttttactagtaaacttgattattgagagcttgagacttgcttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061126.1 RefSeq:Os05g0138300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+'''''OsLti6b''''' '''may act downstream''' of the '''signaling pathway''' involving '''rice orthologues of CBF1/DREB1b'''<ref name="ref1"/>.
-−
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*Two '''closely related genes''' ([[Os07g0635900|''OsLti6a'']], ''OsLti6b''), which are '''induced by low temperature''' during '''seedling emergence''' were '''isolated from''' a cold tolerant temperate japonica rice cultivar<ref name="ref2"/>.
 ===Expression===
-Please input expression information here.
+*Os05g0138300, '''annotated as hydrophobic protein RCI2A '''(Low temperature and salt responsive protein LTI6A), and Os08g0408500, a pathogenesis-related transcriptional factor and ERF domain containing protein, were '''both induced''' when rice varieties grown '''under salt stress''', suggesting that these genes are '''involved in stress signalling''' in both species<ref name="ref4"/>.
 ===Evolution===
-Please input evolution information here.
+*''OsLti6a'' and ''OsLti6b'' encode small molecular weight polypeptides of 6.2 and 6.0 kDa, respectively, and which are '''85% identical''' and '''92% similar''' to '''each other'''. The genes are '''highly conserved across evolutionary kingdoms''' with '''orthologous copies''' in a number of plant species (monocots and dicots) as well as lower forms of eukaryotes<ref name="ref2"/>.
-You can also add sub-section(s) at will.
+===Knowledge Extension===
 ==Labs working on this gene==
-Please input related labs here.
+*Department of Crop, Soil and Environmental Sciences, University of Arkansas, Fayetteville, AR 72701, USA
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 20:04, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os05g0138300\|		GeneName = Os05g0138300\|

@@ Line 70: / Line 70: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]