Os05g0423400 - Revision history

Zhennan at 02:14, 27 March 2017

2017-03-27T02:14:13Z

Guangyi: /* Annotated Information */

2016-11-07T08:07:00Z

‎Annotated Information

Guangyi: /* Mutant */

2016-11-07T08:06:13Z

‎Mutant

Guangyi: /* Annotated Information */

2016-11-07T08:05:47Z

‎Annotated Information

Guangyi: /* Function */

2016-11-07T08:03:30Z

‎Function

Guangyi: /* References */

2016-11-07T08:00:24Z

‎References

Guangyi: /* Labs working on this gene */

2016-11-07T07:59:13Z

‎Labs working on this gene

Guangyi at 07:57, 7 November 2016

2016-11-07T07:57:09Z

Guangyi at 07:56, 7 November 2016

2016-11-07T07:56:23Z

192.168.72.52 at 08:30, 14 May 2015

2015-05-14T08:30:01Z

@@ Line 1: / Line 1: @@
-The rice '''Os05g0423400''' was reported as '''OsMADS4''' in 2005 <ref name="ref1" /> by researchers from the USA.
+The rice '''''Os05g0423400''''' was reported as '''''OsMADS4''''' in 2007 <ref name="ref1" /> by researchers from India.
-<br>
 ==Annotated Information==
 ===Gene Symbol===
-*'''Os05g0423400 <=> OsMADS4'''
+*'''''Os05g0423400''''' '''''<=>''''' '''''OsMADS4'''''
-<br>
 ===Function===
-*'''OsMADS4''' belongs to the class B gene family of floral organ identity determination.
+* The MADS-box family members, identified initially as floral homeotic genes, are one of the most extensively studied transcription factor genes in plants.
-<br>
+* MADS-box genes have a variety of functions. In animals, MADS-box genes are involved in muscle development and cell proliferation and differentiation. Functions in fungi range from pheromone response to arginine metabolism.
-===Mutant===
+===Evolution===
-*Transgenic plants expressing antisense '''OsMADS4''' displayed alterations of the second and third whorls. The second-whorl lodicules, which are equivalent to the petals of dicot plants in grasses, were altered into palea/lemma-like organs, and the third whorl stamens were changed to carpel-like organs.
+* The MADS domain binds to DNA sequences of high similarity to the motif CC[A/T]6GG termed the CArG-box.
-<br>
+* The MADS-box family has been divided into two main groups. The type I consists of ARG80/SRF-like genes of animals and fungi, also designated as M-type genes in plants, and type II contains MEF2-like genes of animals and yeast as well as MIKC-type genes of plants.
 ==Labs working on this gene==
-*Department of Life Science, Pohang University of Science and technology,
+* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110 021, India
-<br>
+* Division of Genetics, Indian Agricultural Research Institute, New Delhi-110 012, India
 ==References==
 <references>
-<ref name="ref1">
+* <ref name="ref1">
-Identification of class B and class C floral organ identity genes from rice
+Arora R, Agarwal P, Ray S, Singh AK, Singh VP, Tyagi AK, Kapoor S. MADS-box
-plants
+gene family in rice: genome-wide identification, organization and expression
 </ref>
 </references>
-<br>
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]

@@ Line 6: / Line 6: @@
 <br>
 ===Function===
-*OsMADS4 belongs to the class B gene family of floral organ identity determination.
+*'''OsMADS4''' belongs to the class B gene family of floral organ identity determination.
 <br>
 ===Mutant===
-*Transgenic plants expressing antisense OsMADS4 displayed alterations of the second and third whorls. The second-whorl lodicules, which are equivalent to the petals of dicot plants in grasses, were altered into palea/lemma-like organs, and the third whorl stamens were changed to carpel-like organs. Loss-of-function analysis of OsMADS3 showed alterations in the third and fourth whorls. In the third whorl, the filaments of the transgenic plants were changed into thick and fleshy bodies, similar to lodicules. Rather than making a carpel, the fourth whorl produced several abnormal flowers.
+*Transgenic plants expressing antisense '''OsMADS4''' displayed alterations of the second and third whorls. The second-whorl lodicules, which are equivalent to the petals of dicot plants in grasses, were altered into palea/lemma-like organs, and the third whorl stamens were changed to carpel-like organs.
 <br>

@@ Line 10: / Line 10: @@
 ===Mutant===
-*Transgenic plants expressing antisense OsMADS4 displayed alterations of the second and third whorls. The second-whorl lodicules, which are equivalent to the petals of dicot plants in grasses, were altered into palea/lemma-like organs, and the third whorl stamens were changed to carpel-like organs. Loss-of-function
+*Transgenic plants expressing antisense OsMADS4 displayed alterations of the second and third whorls. The second-whorl lodicules, which are equivalent to the petals of dicot plants in grasses, were altered into palea/lemma-like organs, and the third whorl stamens were changed to carpel-like organs. Loss-of-function analysis of OsMADS3 showed alterations in the third and fourth whorls. In the third whorl, the filaments of the transgenic plants were changed into thick and fleshy bodies, similar to lodicules. Rather than making a carpel, the fourth whorl produced several abnormal flowers.
 <br>

@@ Line 9: / Line 9: @@
 <br>
-===Expression===
+===Mutant===
-Please input expression information here.
+*Transgenic plants expressing antisense OsMADS4 displayed alterations of the second and third whorls. The second-whorl lodicules, which are equivalent to the petals of dicot plants in grasses, were altered into palea/lemma-like organs, and the third whorl stamens were changed to carpel-like organs. Loss-of-function
+analysis of OsMADS3 showed alterations in the third and fourth whorls. In the third whorl, the filaments of the transgenic plants were changed into thick and fleshy bodies, similar to lodicules. Rather than making a carpel, the fourth whorl produced several abnormal flowers.
-===Evolution===
+<br>
 ==Labs working on this gene==

@@ Line 6: / Line 6: @@
 <br>
 ===Function===
-Please input function information here.
+*OsMADS4 belongs to the class B gene family of floral organ identity determination.
 ===Expression===

← Older revision		Revision as of 08:30, 14 May 2015
Line 20:		Line 20:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]
−	~~GeneName = Os05g0423400\|~~
−	~~Description = Similar to PISTILLATA-like MADS box protein\|~~
−	~~Version = NM_001062125.1 GI:115463980 GeneID:4338842\|~~
−	~~Length = 2303 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os05g0423400, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 5\|Chromosome 5]]\|~~
−	~~AP = Chromosome 5:20766336..20768638\|~~
−	~~CDS = 20766418..20766620,20766757..20766823,20766920..20766978,20767145..20767247,20767375..20767404<br>,20767517..20767561,20768202..20768342\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008398:20766336..20768638~~
−	~~source=RiceChromosome05~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008398:20766336..20768638~~
−	~~source=RiceChromosome05~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggggcgcggcaagatcgagatcaagaggatcgagaactcgacgaaccggcaggtgacgttctcgaagcgccgcgccgggatactcaagaaggcccgcgagatcggcgtgctctgcgacgccgaggtcggcgtcgtcatcttctccagcgccggcaagctctccgactactgcacgcccaagaccacgtccgtgtttcccccgctgtcaaggatcttggagaagtaccagaccaactccgggaagatactctgggatgagaagcacaagagcctcagcgcagagatcgatcgtgtcaagaaggagaacgacaacatgcagatcgagctcaggcatatgaaaggggaggatctgaactccctgcagcccaaggagctgatcgcgatcgaggaggcgctcaacaacggccaggccaatctgcgggacaagatgatggaccactggaggatgcataaaaggaatgagaagatgctggaggacgagcacaagatgttggcttttagggtgcaccagcaggaggtcgagctgagcggcggcataagggagctggagctcggctaccaccacgacgacagggacttcgcggcctcgatgccgttcaccttcagggtgcagcccagccaccccaacctccagcaggagaagtag</cdnaseq>\|
−	AA = <aaseq>MGRGKIEIKRIENSTNRQVTFSKRRAGILKKAREIGVLCDAEVG VVIFSSAGKLSDYCTPKTTSVFPPLSRILEKYQTNSGKILWDEKHKSLSAEIDRVKKE NDNMQIELRHMKGEDLNSLQPKELIAIEEALNNGQANLRDKMMDHWRMHKRNEKMLED EHKMLAFRVHQQEVELSGGIRELELGYHHDDRDFAASMPFTFRVQPSHPNLQQEK</aaseq>\|
−	DNA = <dnaseqindica>83..285#422..488#585..643#810..912#1040..1069#1182..1226#1867..2007#accctcttgtttcttcgagagcgaggtgaagatttgtttcttggtttgtgttcttggagtggaggaggaggaggagttggatatggggcgcggcaagatcgagatcaagaggatcgagaactcgacgaaccggcaggtgacgttctcgaagcgccgcgccgggatactcaagaaggcccgcgagatcggcgtgctctgcgacgccgaggtcggcgtcgtcatcttctccagcgccggcaagctctccgactactgcacgcccaagaccacgtccgtgtttcccccgtctctctctctcctcttccttgtttttttttcttttcttcttttcttgctcttaatttcagtgtttcctgagatatgcatgttctctttgcattgtgtttggcctttaatttgatttgtttttttggcgttttaggctgtcaaggatcttggagaagtaccagaccaactccgggaagatactctgggatgagaagcacaaggtgcgtgcttttctggattattttttttccaaacttttattcctacaaaatcgaatagaaatgcttaaaaaaatgtattcttggaaaacgtttcagagcctcagcgcagagatcgatcgtgtcaagaaggagaacgacaacatgcagatcgagctcaggctagtgtcccaacttattactatcatgcatctttatttctttcacttcctattaattaaagagacaactataaatcacccattgtagcgttttcagctttagattttgctcttgttggggacatcagggatggtggtgatttgtcaagcctgttccatgttgcaggcatatgaaaggggaggatctgaactccctgcagcccaaggagctgatcgcgatcgaggaggcgctcaacaacggccaggccaatctgcgggacaagatggtgattactgtctttgaagcttgatgtttacttcagcatggcatgcagagattgcaagtgccgcatctcttctttttcagagagagtttttgtttctgatgtcacctttgtttccatgatgttgcagatggaccactggaggatgcataaaaggaatgtatgagctctagatatctggatgattcttgtgcttcttttgtggatgatgaagtcaatatcttttgcaagctctgatcactcacctcacatgtctctgtgttcggcttcaggagaagatgctggaggacgagcacaagatgttggcttttagggtggtaatttccttcagagtaacttgtttttctattgaactttcacttgaaaaattccttgtgttctcatttctatttctaaaaaccatctgaaattgaggacaaataccatctgatataactgctctaactgttcaactaggttcgataataagtgacccttcgtagttgcgcctatcactactttagctatttttcagtgccatgctcattctaatgcggtcacttagatcactggtcaatattcaatcagaaccattctacgcaacaaatctctagactaactacccctgcattcagaattcatatagcgattgaaaattgaactccgtgcacggtagtagtagtagtcagatctattgtttctaatcaattgctatatggattcagaatgcaggtgtagtttgttcatatatgacaaaacatcctattgaatcttgaccagtgatctaattgactgctccattagatgttatcatctatgaacaaactacccctgcattctggatccatatagcaattgatcagaaatgccagatctgattactacttccctgcacagagctcaaacctcagtgagggaagctttactgaaagaagcctgaaagctgagagttcactgagctcctccccgtgttttcagcaccagcaggaggtcgagctgagcggcggcataagggagctggagctcggctaccaccacgacgacagggacttcgcggcctcgatgccgttcaccttcagggtgcagcccagccaccccaacctccagcaggagaagtaggctgctgagcactgccaatttggctgaacctcctgcttgctagctttgcatttcctcatgcgctgctagatgtatctgtggtttctctcatgcctgtctgaatgaactcacactgatgagagggtgtcagttgttttgtgctcctcccagcattagcactcagaattcagaaatgactcaatgtcagttgcttttgtgcttctcccagcattagcactcagaattcagaaatgactcaatgtcagttgcttttgtgcttctccctgcttgtttaattagccactgttcttgtttcc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062125.1 RefSeq:Os05g0423400]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 5]]~~
−	~~[[Category:~~Chromosome 5]]