Os05g0542500 - Revision history

Xysj2019 at 10:25, 2 March 2017

2017-03-02T10:25:56Z

Xysj2017: /* Labs working on this gene */

2017-02-15T00:52:58Z

‎Labs working on this gene

192.168.72.52: /* Structured Information */

2015-06-12T07:43:05Z

‎Structured Information

Zhangye at 15:37, 4 March 2015

2015-03-04T15:37:29Z

Zhangye at 15:36, 4 March 2015

2015-03-04T15:36:28Z

124.16.129.48 at 20:14, 22 July 2012

2012-07-22T20:14:09Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os05g0542500| Description = LEA-like protein| Version = NM_001062730.1 GI:115465190 GeneID:4339480| Length = 1271 bp| Definition = Oryza sativa..."

2012-06-24T10:31:48Z

Created page with "{{JaponicaGene| GeneName = Os05g0542500| Description = LEA-like protein| Version = NM_001062730.1 GI:115465190 GeneID:4339480| Length = 1271 bp| Definition = Oryza sativa..."

New page

{{JaponicaGene|
GeneName = Os05g0542500|
Description = LEA-like protein|
Version = NM_001062730.1 GI:115465190 GeneID:4339480|
Length = 1271 bp|
Definition = Oryza sativa Japonica Group Os05g0542500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
AP = Chromosome 5:26988852..26990122|
CDS = 26988953..26989012,26989105..26989491,26989703..26989858|
GCID = <gbrowseImage1>
name=NC_008398:26988852..26990122
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008398:26988852..26990122
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcttcccaccaggaccaggctagctaccgcgccggcgagaccaaggcccacaccgaggagaaggcggggcaggtgatgggggcgagcaaggacaaggcgagcgaggcgaaggacagggcgtcggaggcggcggggcacgccgccggcaaggggcaggataccaaggaggcgacgaaggagaaggcgcaggcggcgaaggagagggcgtcggagacggcgcaggcggcgaaggacaagacctccagcacgtcgcaggcggcgagggacaaagccgccgagagcaaggaccagaccggcggcttcctcggcgagaagaccgagcaggccaagcagaaggccgccgagaccgctggcgccgccaagcagaagaccgccgagacggcgcagtacaccaaggactctgccatcgccggcaaggacaagaccggcagcgtcctccaacaggcgagtgagcaggtgaagagcacggtggtcggcgccaaggacgcggtgatgagcacgctggggatgaccgaagacgaggccggcaccgacgacggcgccaacaaggacacctctgccaccgccgccgccacggagacgacggcgagggatcactag</cdnaseq>|
AA = <aaseq>MASHQDQASYRAGETKAHTEEKAGQVMGASKDKASEAKDRASEA AGHAAGKGQDTKEATKEKAQAAKERASETAQAAKDKTSSTSQAARDKAAESKDQTGGF LGEKTEQAKQKAAETAGAAKQKTAETAQYTKDSAIAGKDKTGSVLQQASEQVKSTVVG AKDAVMSTLGMTEDEAGTDDGANKDTSATAAATETTARDH</aaseq>|
DNA = <dnaseqindica>102..161#254..640#852..1007#agccagtgcaaatctgatcgatcaagataatcgagcaaaatccatcagagttctaacattcgcgcgtgaatttcgaggttaatttttgaagcttaggatcaatggcttcccaccaggaccaggctagctaccgcgccggcgagaccaaggcccacaccgaggtcagcgtcagccaccaccggccggccatcttctccagctccggcgagcttccagttaatttgttgatcacttgattgttcttggtgtgcaggagaaggcggggcaggtgatgggggcgagcaaggacaaggcgagcgaggcgaaggacagggcgtcggaggcggcggggcacgccgccggcaaggggcaggataccaaggaggcgacgaaggagaaggcgcaggcggcgaaggagagggcgtcggagacggcgcaggcggcgaaggacaagacctccagcacgtcgcaggcggcgagggacaaagccgccgagagcaaggaccagaccggcggcttcctcggcgagaagaccgagcaggccaagcagaaggccgccgagaccgctggcgccgccaagcagaagaccgccgagacggcgcagtacaccaaggactctgccatcgccggcaaggacaagaccggcagcgtcctccaacaggtacacacaggattaaaagcaattctacctcctttttttttttttttgcggggagcagaggtaccgtgagataaaaaaatacggtaccagttattaaatttacaatagaaaaagtagtaccttcttaagcactgtaaaattgctctttgattagtttctcctcgtcgaacaccattgttgtggatcttgaggagaattgtttgtgtttcaggcgagtgagcaggtgaagagcacggtggtcggcgccaaggacgcggtgatgagcacgctggggatgaccgaagacgaggccggcaccgacgacggcgccaacaaggacacctctgccaccgccgccgccacggagacgacggcgagggatcactagacgccgtgaatgatttccctttgggtctatttatgtatgttttcacttcaaattcggtgcaagtttgaatttgtttttgtgtcgttttgagtctgtatcgatgctgtatgaagtggtggtcgtcgcaggggaggatttctgacgggtgtgggtgatgtgtactgatgatgttcagttgttttcgtcagagtttctcgtctgtgttctgtttattatggcgtaacaataataaaagtttgggcctaaagcccgcatttgtggttt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062730.1 RefSeq:Os05g0542500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Function===
 *The promoter of ''OsLEA3-1'' isolated from the upland rice IRAT109 '''exhibits strong activity''' under '''drought'''- and '''salt-stress conditions'''<ref name="ref1"/>. Overexpression of '''''FON1''''' could '''upregulate ''LEA3''''' and '''''OsbZIP46'''''<ref name="ref3"/>.

@@ Line 40: / Line 40: @@
 ==Labs working on this gene==
 *National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
-*Laboratorium voor Genetica, Department of Genetics, Flanders Interuniversity Institute for Biotechnology (VIB), Universiteit Gent,
+*Laboratorium voor Genetica, Department of Genetics, Flanders Interuniversity Institute for Biotechnology (VIB), Universiteit Gent, K.L. Ledeganckstraat 35, B-9000 Gent, Belgium
 ==References==

← Older revision		Revision as of 15:37, 4 March 2015
Line 1:		Line 1:
−	The rice gene Os05g0542500 was reported as '''''OsLEA3-1''''' in 2007<ref name="ref1"/>, '''''OsLEA3-1''''' in 1997<ref name="ref2"/>, respectively.	+	The rice gene Os05g0542500 was reported as '''''OsLEA3-1''''' in 2007<ref name="ref1"/>, '''''OsLEA3''''' in 1997<ref name="ref2"/>, respectively.

	==Annotated Information==		==Annotated Information==

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice gene Os05g0542500 was reported as '''''OsLEA3-1'''''  in 2007<ref name="ref1"/>, '''''OsLEA3-1''''' in 1997<ref name="ref2"/>, respectively.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*The promoter of ''OsLEA3-1'' isolated from the upland rice IRAT109 '''exhibits strong activity''' under '''drought'''- and '''salt-stress conditions'''<ref name="ref1"/>. Overexpression of '''''FON1''''' could '''upregulate ''LEA3''''' and '''''OsbZIP46'''''<ref name="ref3"/>.
 ===Expression===
-Please input expression information here.
+*''OsLEA3-1'' is '''induced by drought''', '''salt''' and '''abscisic acid''' (ABA), but not by cold stress. '''Drought resistance''' of transgenic lines over-expressing the ''OsLEA3-1'' gene can be improved through selections in terms of the relative yield in the T<sub>1</sub>generation or yield in the T<sub>2</sub> or later generations under the field conditions<ref name="ref1"/>.
 ===Evolution===
-Please input evolution information here.
+*''OsLEA3-1'' '''protein sequence''' has '''97% identity''' to ''OsLEA3'' in rice and ''OsLEA3-1'' is considered to '''be an allele of ''OsLEA3''''' based on its location in the rice genome. The OsLEA3-1 protein has '''56% identity''' to ''HVA1'' from barley, '''52% identity''' to group 3 LEA protein ''MGL3'' from maize, and '''53% identity''' to group 3 LEA protein pMA2005 from wheat as revealed by ClustalW<ref name="ref1"/>.
-You can also add sub-section(s) at will.
+*Group 3 LEA proteins are composed principally of tandem repeats of an 11-mer amino acid motif, forming an amphiphilic helix that readily binds ions. LEA genes are suggested to be involved in tolerance to cellular dehydration upon desiccation, salt stress, or cold, although direct evidence is still lacking<ref name="ref4"/>.
 ==Labs working on this gene==
-Please input related labs here.
+*National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 20:14, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os05g0542500\|		GeneName = Os05g0542500\|

@@ Line 60: / Line 60: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]