Os05g0552300 - Revision history

192.168.72.52: /* Structured Information */

2015-06-12T07:43:59Z

‎Structured Information

Cecacace at 10:21, 10 June 2014

2014-06-10T10:21:36Z

Cecacace at 10:19, 10 June 2014

2014-06-10T10:19:56Z

Cecacace: /* Annotated Information */

2014-06-10T10:09:12Z

‎Annotated Information

124.16.129.48 at 20:14, 22 July 2012

2012-07-22T20:14:28Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os05g0552300| Description = Similar to Guanine nucleotide-binding protein beta subunit-like protein (GPB-LR) (RWD)| Version = NM_001062789.1 GI:1..."

2012-06-24T10:32:49Z

Created page with "{{JaponicaGene| GeneName = Os05g0552300| Description = Similar to Guanine nucleotide-binding protein beta subunit-like protein (GPB-LR) (RWD)| Version = NM_001062789.1 GI:1..."

New page

{{JaponicaGene|
GeneName = Os05g0552300|
Description = Similar to Guanine nucleotide-binding protein beta subunit-like protein (GPB-LR) (RWD)|
Version = NM_001062789.1 GI:115465308 GeneID:4339539|
Length = 2500 bp|
Definition = Oryza sativa Japonica Group Os05g0552300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
AP = Chromosome 5:27540943..27543442|
CDS = 27541267..27541383,27542475..27543368|
GCID = <gbrowseImage1>
name=NC_008398:27540943..27543442
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008398:27540943..27543442
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgggccaggagtcgctcaccctggcgggcgtcctgcgcggccacaacgacatggtgacggcgatcgcggcgccgattgacaactcgcccttcatcgtctcctcctcccgcgacaagtcgctgctggtgtgggacatcaccaacccgtccaccgccgtggccacggatcccgaggcggccccgccggagtacggcgtctcgtaccgccgcctcaccggccactcccacttcgtccaggacgtcgtcctcagctccgacggccagttcgcgctctcgggatcctgggacggcgagctccgcctctgggacctagccaccggccgcaccacccgccgcttcgtcggccacaccaaggacgtcctctccgtcgccttctccgtcgacaaccgccagatcgtctccgcggcgcgcgacaacaccatcaagctctggaacaccctcggcgagtgcaagtacaccatcggcggcgaccatggcgccggcgagggccacaccgggtgggtctcctgcgtcagattctcccccaaccccatggcccccaccatcgtctccggctcgtgggatcgcagcgtcaaggtctggaacctcacgaactgcaagctgcgcaccaagctcgagggccacaacggctacgtcaacgccgtcgccgtgagcccagacggctccttgtgtgcctccggtgggaaggacggaaccaccctgctctgggatctcaccgaggggaagatgctgtacaagctcgacgccggcgccatcatccactccctctgcttctcgcccaaccgctactggctctgcgccgcgacagaggactccgtcaagatctgggacctcgagtccaagctcgtcatgcaggacctcaagccagaagtccaggccttcaagagccagatgctgtactgcacaagtttgagctggagcgctgatggcagcaccctcttcgctggctacactgatggaactatcagggtttggaaggtctcagggtttggcggctatgcaatctag</cdnaseq>|
AA = <aaseq>MAGQESLTLAGVLRGHNDMVTAIAAPIDNSPFIVSSSRDKSLLV WDITNPSTAVATDPEAAPPEYGVSYRRLTGHSHFVQDVVLSSDGQFALSGSWDGELRL WDLATGRTTRRFVGHTKDVLSVAFSVDNRQIVSAARDNTIKLWNTLGECKYTIGGDHG AGEGHTGWVSCVRFSPNPMAPTIVSGSWDRSVKVWNLTNCKLRTKLEGHNGYVNAVAV SPDGSLCASGGKDGTTLLWDLTEGKMLYKLDAGAIIHSLCFSPNRYWLCAATEDSVKI WDLESKLVMQDLKPEVQAFKSQMLYCTSLSWSADGSTLFAGYTDGTIRVWKVSGFGGY AI</aaseq>|
DNA = <dnaseqindica>2060..2176#75..968#ctctcctagccttcccctcctccgccgccgccatctgccgtcgagagccccggttgcccacccccgcggcgacgatggcgggccaggagtcgctcaccctggcgggcgtcctgcgcggccacaacgacatggtgacggcgatcgcggcgccgattgacaactcgcccttcatcgtctcctcctcccgcgacaagtcgctgctggtgtgggacatcaccaacccgtccaccgccgtggccacggatcccgaggcggccccgccggagtacggcgtctcgtaccgccgcctcaccggccactcccacttcgtccaggacgtcgtcctcagctccgacggccagttcgcgctctcgggatcctgggacggcgagctccgcctctgggacctagccaccggccgcaccacccgccgcttcgtcggccacaccaaggacgtcctctccgtcgccttctccgtcgacaaccgccagatcgtctccgcggcgcgcgacaacaccatcaagctctggaacaccctcggcgagtgcaagtacaccatcggcggcgaccatggcgccggcgagggccacaccgggtgggtctcctgcgtcagattctcccccaaccccatggcccccaccatcgtctccggctcgtgggatcgcagcgtcaaggtctggaacctcacgaactgcaagctgcgcaccaagctcgagggccacaacggctacgtcaacgccgtcgccgtgagcccagacggctccttgtgtgcctccggtgggaaggacggaaccaccctgctctgggatctcaccgaggggaagatgctgtacaagctcgacgccggcgccatcatccactccctctgcttctcgcccaaccgctactggctctgcgccgcgacagaggactccgtcaagatctgggacctcgagtccaagctcgtcatgcaggacctcaagccagaagtccaggccttcaagagccaggtataccttttgcactttgcctctctcgttagccttgcttgtcacatgtatcgtgcattcgttgctgcctgaatctgaataggatgtaccgcgtgatgcatgttctgtcgttctgtctgattaggatgtattgtgtgattcgttccatcgtggttctcgcgtgttgcattttggattcctggtgctattattgttacgcccttcaatttatcaggatcctctgtagtaggatagggtagttttgatgcttattaagctcattgcgagcaggttatccaatttaactcacagcatcatgttcatgtggtcaagcatcacatgtacgtatgttatcagcaggtcatatacataattagtcccgctgatttatatttctaggtaccgaatcctctgttctgtgttgatctaatgatctaatcagttttatgatctgttctcagtaatacgtactcatcaatgatgctgttgatgtttatgctcatcccttctccactgaattgtatacatgtatttatattactatatactaagtagatataaaatgctgcattttatttgtttacatgttagtttcatcaaccatggtgctgattggtccctcatgtgcctgtgtaactatttggaaaccagcatttcggtatacctctgcatatccttgtagagctgtagcaatattagtctctgctataagtaattcaatttaacttcaaactataatttgaccgcaccttctcactagagtggtacagttttgacaaagttgatctttacaccttgaattttgtgttagttttgcaaacttttcttaatgttatgttttgtttattttctaccacggaaaccttttctgttacagttctcataccccttttgattgagcacatgcaatttgttatagaggatgtgcattctccttgaaatctcaatagtccttaaattgttctattgtgcactttggctgtttccccctagacttatattctactgtgcaccttgtattaatatgtattcaattctttaactgaacttgattacgcatttattttccttaaaaagaatgtgtactgacacctgccgttacatttgcttagatgctgtactgcacaagtttgagctggagcgctgatggcagcaccctcttcgctggctacactgatggaactatcagggtttggaaggtctcagggtttggcggctatgcaatctaggtggtgaatttgttgaaaggcttaggaatcttaatttaaacatcgtgatgcctatcaagtttttgacagttctgaggcataacatttgcctggtactttctacttcattttcattaattaatgattagatttgccaatgagcttatcggtactctggaactatggaagaggatccttatgcatattttttgtttttggctaagttgaaaagatattagttatgcaactttcggagcctcattgcctagatgtaaataatgcttcatcaattgctattttctgatgattttgatggtgctaattagcttttcatctgccgctgat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062789.1 RefSeq:Os05g0552300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]

@@ Line 25: / Line 25: @@
 *Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama 222-8567, Japan.
 *Sainsbury Laboratory, John Innes Centre, Norwich NR4 7UH, United Kingdom.
 ==References==
 * <ref name="ref1">
 Ayako Nakashima, Letian Chen, et al. RACK1 Functions in Rice Innate Immunity by Interacting with the Rac1 Immune Complex. The Plant Cell, Vol. 20: 2265–2279, August 2008.
@@ Line 31: / Line 33: @@
 * <ref name="ref2">
 Dongping Zhang, Li Chen, et al. OsRACK1 Is Involved in Abscisic Acid- and H2O2-Mediated Signaling to Regulate Seed Germination in Rice (Oryza sativa, L.).PLOS ONE | www.plosone.org 2 May 2014 | Volume 9 | Issue 5 | e97120.
 ==Structured Information==

@@ Line 2: / Line 2: @@
 The gene Os05g0552300 encodes a protein called the receptor for activated C kinase 1 (RACK1), which is one member of the most important WD repeat–containing family of proteins found in all eukaryotes and is involved in multiple signaling pathways<ref name="ref1" />.
 ==Annotated Information==
 ===Function===
 '''T'''he gene is composed of 2 exons and encodes a protein of 336 amino acids, RACK1(Receptor for Activated C-Kinase 1).RACK1 functions in various mammalian signaling pathways and is involved in hormone signaling and development in plants. Rice contains two RACK1 genes, RACK1A and RACK1B, and the RACK1A protein interacts with the GTP form of Rac1. Rac1 positively regulates RACK1A at both the transcriptional and posttranscriptional levels. RACK1A transcription was also induced by a fungal elicitor and by abscisic acid, jasmonate, and auxin. Analysis of transgenic rice plants and cell cultures indicates that RACK1A plays a role in the production of reactive oxygen species (ROS) and in
 resistance against rice blast infection. Overexpression of RACK1A enhances ROS production in rice seedlings. RACK1A was shown to interact with the N terminus of NADPH oxidase, RAR1, and SGT1, key regulators of plant disease resistance. These results suggest that RACK1A functions in rice innate immunity by interacting with multiple proteins in the Rac1<ref name="ref2" />.
 immune complex.
 ===Expression===
-In rice, RACK1A gene(OsRACK1A) plays an important role in controlling seed germination and its molecular mechanisms by generating a series of transgenic rice lines, of which OsRACK1A was either over-expressed or under-expressed. OsRACK1A positively regulated seed germination and negatively regulated the responses of seed germination to both exogenous ABA and H2O2. Inhibition of ABA biosynthesis had no enhancing effect on germination, whereas inhibition of ABA catabolism significantly suppressed germination. ABA inhibition on seed germination was almost fully recovered by exogenous H2O2 treatment. Quantitative analyses showed that endogenous ABA levels were significantly higher and H2O2 levels significantly lower in OsRACK1Adown regulated transgenic lines as compared with those in wildtype or OsRACK1A-up regulated lines. Quantitative real-time PCR analyses showed that the transcript levels of OsRbohs and amylase genes, RAmy1A and RAmy3D, were significantly lower in OsRACK1A-down regulated transgenic lines. It is concluded that OsRACK1A positively regulates seed germination by controlling endogenous levels of ABA and H2O2 and their interaction<ref name="ref3" />.
+In rice, RACK1A gene(OsRACK1A) plays an important role in controlling seed germination and its molecular mechanisms by generating a series of transgenic rice lines, of which OsRACK1A was either over-expressed or under-expressed. OsRACK1A positively regulated seed germination and negatively regulated the responses of seed germination to both exogenous ABA and H2O2. Inhibition of ABA biosynthesis had no enhancing effect on germination, whereas inhibition of ABA catabolism significantly suppressed germination. ABA inhibition on seed germination was almost fully recovered by exogenous H2O2 treatment. Quantitative analyses showed that endogenous ABA levels were significantly higher and H2O2 levels significantly lower in OsRACK1Adown regulated transgenic lines as compared with those in wildtype or OsRACK1A-up regulated lines. Quantitative real-time PCR analyses showed that the transcript levels of OsRbohs and amylase genes, RAmy1A and RAmy3D, were significantly lower in OsRACK1A-down regulated transgenic lines. It is concluded that OsRACK1A positively regulates seed germination by controlling endogenous levels of ABA and H2O2 and their interaction<ref name="ref1" />.
 ===Evolution===
 Please input evolution information here.
@@ Line 15: / Line 18: @@
 ==Labs working on this gene==
-Please input related labs here.
+*Department of Biotechnology, College of Bioscience and Biotechnology, Yangzhou University, Jiangsu, China.
+*Department of Biological Engineering, Huanghuai University, Zhumadian City, Henan Province, China.
 ==References==
-Please input cited references here.
+* <ref name="ref1">
 ==Structured Information==

@@ Line 1: / Line 1: @@
 Please input one-sentence summary here.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+'''T'''he gene is composed of 2 exons and encodes a protein of 336 amino acids, RACK1(Receptor for Activated C-Kinase 1).RACK1 functions in various mammalian signaling pathways and is involved in hormone signaling and development in plants. Rice contains two RACK1 genes, RACK1A and RACK1B, and the RACK1A protein interacts with the GTP form of Rac1. Rac1 positively regulates RACK1A at both the transcriptional and posttranscriptional levels. RACK1A transcription was also induced by a fungal elicitor and by abscisic acid, jasmonate, and auxin. Analysis of transgenic rice plants and cell cultures indicates that RACK1A plays a role in the production of reactive oxygen species (ROS) and in
+resistance against rice blast infection. Overexpression of RACK1A enhances ROS production in rice seedlings. RACK1A was shown to interact with the N terminus of NADPH oxidase, RAR1, and SGT1, key regulators of plant disease resistance. These results suggest that RACK1A functions in rice innate immunity by interacting with multiple proteins in the Rac1<ref name="ref2" />.
 ===Expression===
-Please input expression information here.
+In rice, RACK1A gene(OsRACK1A) plays an important role in controlling seed germination and its molecular mechanisms by generating a series of transgenic rice lines, of which OsRACK1A was either over-expressed or under-expressed. OsRACK1A positively regulated seed germination and negatively regulated the responses of seed germination to both exogenous ABA and H2O2. Inhibition of ABA biosynthesis had no enhancing effect on germination, whereas inhibition of ABA catabolism significantly suppressed germination. ABA inhibition on seed germination was almost fully recovered by exogenous H2O2 treatment. Quantitative analyses showed that endogenous ABA levels were significantly higher and H2O2 levels significantly lower in OsRACK1Adown regulated transgenic lines as compared with those in wildtype or OsRACK1A-up regulated lines. Quantitative real-time PCR analyses showed that the transcript levels of OsRbohs and amylase genes, RAmy1A and RAmy3D, were significantly lower in OsRACK1A-down regulated transgenic lines. It is concluded that OsRACK1A positively regulates seed germination by controlling endogenous levels of ABA and H2O2 and their interaction<ref name="ref3" />.
 ===Evolution===
 Please input evolution information here.

← Older revision		Revision as of 20:14, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os05g0552300\|		GeneName = Os05g0552300\|

@@ Line 37: / Line 37: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]