Os05g0572000 - Revision history

Guangyi at 06:19, 13 March 2017

2017-03-13T06:19:55Z

Guangyi at 12:58, 9 March 2017

2017-03-09T12:58:08Z

192.168.72.52 at 08:39, 14 May 2015

2015-05-14T08:39:07Z

124.16.129.48 at 20:15, 22 July 2012

2012-07-22T20:15:11Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os05g0572000| Description = Conserved hypothetical protein| Version = NM_001062912.2 GI:297604944 GeneID:4339670| Length = 354 bp| Definition =..."

2012-06-24T10:34:58Z

Created page with "{{JaponicaGene| GeneName = Os05g0572000| Description = Conserved hypothetical protein| Version = NM_001062912.2 GI:297604944 GeneID:4339670| Length = 354 bp| Definition =..."

New page

{{JaponicaGene|
GeneName = Os05g0572000|
Description = Conserved hypothetical protein|
Version = NM_001062912.2 GI:297604944 GeneID:4339670|
Length = 354 bp|
Definition = Oryza sativa Japonica Group Os05g0572000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
AP = Chromosome 5:28581234..28581587|
CDS = 28581234..28581587|
GCID = <gbrowseImage1>
name=NC_008398:28581234..28581587
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008398:28581234..28581587
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacggccgcgactgccccgacaacctgcgccaactccgcgacgccgtcgacgccaagatccaggccatccgcgtccgcatggcgcgcaagcgcgcgcgcgcgcgccgccagcgcgaggagagcaagaagagccaacgcgccgaggacgcgaaggcggcgacgccgtctcgccccgtggcctccgagcgcgccgcgtccgagacgacgacgacgacaaccacgacgtcgtcgtcgtacgggtcaccggacggcgtgctctccatgagcgcggcgtccgtcgacggcgactgcccgctcgagcggatgccgtcgttcgatcccgagttgatctgggagatgcttaacttctag</cdnaseq>|
AA = <aaseq>MDGRDCPDNLRQLRDAVDAKIQAIRVRMARKRARARRQREESKK SQRAEDAKAATPSRPVASERAASETTTTTTTTSSSYGSPDGVLSMSAASVDGDCPLER MPSFDPELIWEMLNF</aaseq>|
DNA = <dnaseqindica>1..354#atggacggccgcgactgccccgacaacctgcgccaactccgcgacgccgtcgacgccaagatccaggccatccgcgtccgcatggcgcgcaagcgcgcgcgcgcgcgccgccagcgcgaggagagcaagaagagccaacgcgccgaggacgcgaaggcggcgacgccgtctcgccccgtggcctccgagcgcgccgcgtccgagacgacgacgacgacaaccacgacgtcgtcgtcgtacgggtcaccggacggcgtgctctccatgagcgcggcgtccgtcgacggcgactgcccgctcgagcggatgccgtcgttcgatcccgagttgatctgggagatgcttaacttctag</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062912.2 RefSeq:Os05g0572000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]

@@ Line 7: / Line 7: @@
 ===Function===
 * Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
-* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and
+* It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.
 * Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).<ref name="ref2" />
 ===Evolution===
 * The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 * The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.
-* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain,
+* The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
 * The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.
-which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.
+* Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.<ref name="ref3" />
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology,
+* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.);
 * Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)
@@ Line 39: / Line 27: @@
 <references>
 * <ref name="ref1">
-Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.
+Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.
 </ref>
 * <ref name="ref2">
-Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238
+Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov 8;298(5596):1238-41. PubMed PMID: 12424380.
 </ref>
 * <ref name="ref3">

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os05g0572000''''' was reported as '''''OsERF#052''''' in 2006 <ref name="ref1" /> by researchers from Japan.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+* Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.
-===Expression===
+development, as well as various responses to environmental stimuli.
-Please input expression information here.
+* Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem
 ===Evolution===
-Please input evolution information here.
+* The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology,
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==
-      [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]
+      [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 4]]

← Older revision		Revision as of 08:39, 14 May 2015
Line 20:		Line 20:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]
−	~~GeneName = Os05g0572000\|~~
−	~~Description = Conserved hypothetical protein\|~~
−	~~Version = NM_001062912.2 GI:297604944 GeneID:4339670\|~~
−	~~Length = 354 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os05g0572000, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 5\|Chromosome 5]]\|~~
−	~~AP = Chromosome 5:28581234..28581587\|~~
−	~~CDS = 28581234..28581587\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008398:28581234..28581587~~
−	~~source=RiceChromosome05~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008398:28581234..28581587~~
−	~~source=RiceChromosome05~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggacggccgcgactgccccgacaacctgcgccaactccgcgacgccgtcgacgccaagatccaggccatccgcgtccgcatggcgcgcaagcgcgcgcgcgcgcgccgccagcgcgaggagagcaagaagagccaacgcgccgaggacgcgaaggcggcgacgccgtctcgccccgtggcctccgagcgcgccgcgtccgagacgacgacgacgacaaccacgacgtcgtcgtcgtacgggtcaccggacggcgtgctctccatgagcgcggcgtccgtcgacggcgactgcccgctcgagcggatgccgtcgttcgatcccgagttgatctgggagatgcttaacttctag</cdnaseq>\|
−	~~AA = <aaseq>MDGRDCPDNLRQLRDAVDAKIQAIRVRMARKRARARRQREESKK SQRAEDAKAATPSRPVASERAASETTTTTTTTSSSYGSPDGVLSMSAASVDGDCPLER MPSFDPELIWEMLNF</aaseq>\|~~
−	DNA = <dnaseqindica>1..354#atggacggccgcgactgccccgacaacctgcgccaactccgcgacgccgtcgacgccaagatccaggccatccgcgtccgcatggcgcgcaagcgcgcgcgcgcgcgccgccagcgcgaggagagcaagaagagccaacgcgccgaggacgcgaaggcggcgacgccgtctcgccccgtggcctccgagcgcgccgcgtccgagacgacgacgacgacaaccacgacgtcgtcgtcgtacgggtcaccggacggcgtgctctccatgagcgcggcgtccgtcgacggcgactgcccgctcgagcggatgccgtcgttcgatcccgagttgatctgggagatgcttaacttctag</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062912.2 RefSeq:Os05g0572000]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 5]]~~
−	~~[[Category:~~Chromosome 5]]

← Older revision		Revision as of 20:15, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os05g0572000\|		GeneName = Os05g0572000\|