Os05g0588500 - Revision history

192.168.72.52: /* Structured Information */

2015-06-12T07:46:33Z

‎Structured Information

Wujiayi at 15:03, 7 June 2014

2014-06-07T15:03:06Z

Wujiayi at 15:01, 7 June 2014

2014-06-07T15:01:51Z

Wujiayi at 15:00, 7 June 2014

2014-06-07T15:00:11Z

Wujiayi at 13:21, 7 June 2014

2014-06-07T13:21:56Z

124.16.129.48 at 20:15, 22 July 2012

2012-07-22T20:15:46Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os05g0588500| Description = MtN3 and saliva related transmembrane protein family protein| Version = NM_001063010.1 GI:115465750 GeneID:4339772| ..."

2012-06-24T10:36:43Z

Created page with "{{JaponicaGene| GeneName = Os05g0588500| Description = MtN3 and saliva related transmembrane protein family protein| Version = NM_001063010.1 GI:115465750 GeneID:4339772| ..."

New page

{{JaponicaGene|
GeneName = Os05g0588500|
Description = MtN3 and saliva related transmembrane protein family protein|
Version = NM_001063010.1 GI:115465750 GeneID:4339772|
Length = 1812 bp|
Definition = Oryza sativa Japonica Group Os05g0588500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
AP = Chromosome 5:29394637..29396448|
CDS = 29394950..29395081,29395237..29395356,29395475..29395890,29396068..29396113|
GCID = <gbrowseImage1>
name=NC_008398:29394637..29396448
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008398:29394637..29396448
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatgaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacgataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtag</cdnaseq>|
AA = <aaseq>MVMNPDAVRNVVGIIGNLISFGLFLSPLPTFVTIVKKKDVEEFV PDPYLATFLNCALWVFYGLPFIHPNSILVVTINGTGLLIEIAYLAIYFAYAPKPKRCR MLGVLTVELVFLAAVAAGVLLGAHTYDKRSLIVGTLCVFFGTLMYAAPLTIMKQVIAT KSVEYMPFTLSLVSFINGICWTIYAFIRFDILITIPNGMGTLLGAAQLILYFCYYDGS TAKNKGALELPKDGDSSAV</aaseq>|
DNA = <dnaseqindica>1368..1499#1093..1212#559..974#336..381#gtgctctgcctctccattattccgactctcgtaagattaaggggggaggaattggagggcagaggccgccattttaatcagtggaaataaaatccacgcattttatatatttaatttaacccccaattttaacttagcagcacactagctagctagctgctaagttaactatttgatcaggttacagttgctggcctgacagttaattaatctcttgctggttgattagttgctatcagctacacgctctcgctagctgccactgtactaatacatactcccatctattcgcctgagaaaatatcgaaaagtagcagcaaagaggagcaggcaagatggtgatgaaccctgacgccgtccgcaatgtcgttggaatcatcggtacgtcgtctcgaattgaacctgcttgtagatgcttcatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatattgatcgaacattagtaattgactaataattgattaattgtactaggtaacttgatatcgttcgggttgttcttgtcgccattgccgacgttcgtgacgatcgtgaagaagaaggacgtggaggagttcgtgccggatccgtacctggcgacgttcctcaactgcgcgctgtgggtgttctacggcctacccttcatccaccccaacagcatcctcgtcgtcaccatcaacggcaccggactcctcatcgagatcgcctacctcgccatctacttcgcctacgcccccaagcccaagcggtgcaggatgctcggcgtcctcaccgtggagctcgtcttcctcgccgccgtcgccgccggcgtgctcctcggcgcccacacctacgacaagcgctcgctcatcgttggcaccctctgcgtcttcttcggcaccctcatgtacgccgcgccgctcaccatcatggtatgtgtatatatatctgtcgattattaattttttgcatgaatctgatctgatgattaattatttgatttatatgtgtgtggcaaaatgatgtaattactacatggaatgaatgtagaaacaagtgatcgcgacaaagagcgtggagtacatgcccttcacgttgtcgctggtgagcttcatcaacggcatatgctggacaatatacgcgttcatccgctttgacatcctcatcacggtatacatattatgcatgcatatatatatatatgctttcaattatctcataaataattactaggatcagtaagtagtatagttgttattataatcatagagtaattctagctaatagtactatatattaatgtatcataattaataaataaatagataccgaacggcatggggacgctgctgggcgcggcgcagttgatcctctacttctgctactacgacgggtcgacggccaagaacaagggcgccctcgagctgcccaaggacggcgactcctccgctgtgtagctacatatgctatatatcttgccatgcaaagaaccacaagatcgaagctaacacaaaccatgcagcatatatgcacatcacacatgcagtatcacaacgtacgcatgcttggatctgcacgcaccacgcgcgcgtgcatgtaactgtgacgggttataatcgatctgttggatggatatggatcatggatgcaggcaatgcagctgctcttctgtttggacccactgaattcgcccgtgcatgcaggcagcttctttgtgtgtgtacatatccaactatgcaagaggcaggtatatgtgagcaaaaggccccc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063010.1 RefSeq:Os05g0588500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]

@@ Line 32: / Line 32: @@
 </references>
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 18: / Line 18: @@
 ==References==
 <references>
-* <ref name="ref1">
+ <ref name="ref1">
-Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.
+Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.</ref>
-* <ref name="ref2">
+ <ref name="ref2">
-Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.
+Yuan M, Wang S (2013) Rice MtN3/Saliva/SWEET family genes and their homologs in cellular organisms. Mol Plant 6: 665–674.</ref>
-* <ref name="ref3">
+<ref name="ref3">
-Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210
+Zhou Y, Liu L, Huang W, Yuan M, Zhou F, et al. (2014) Overexpression of OsSWEET5 in Rice Causes Growth Retardation and Precocious Senescence. PLoS ONE 9(4): e94210. doi:10.1371/journal.pone.0094210</ref>
-* <ref name="ref4">
+<ref name="ref4">
-Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.
+Anker L (1974) Auxin-synthesis inhibition by sugars, notably by galactose. Acta Bot Neerl 23: 705–714.</ref>
-* <ref name="ref5">
+<ref name="ref5">
-Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.
+Cheung SP, Cleland RE (1991) Galactose inhibits auxin-induced growth of Avena coleoptiles by two mechanisms. Plant Cell Physiol 32: 1015–1019.</ref>
-* <ref name="ref6">
+ <ref name="ref6">
-Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.
+Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.</ref>
 </references>
 ==Structured Information==

@@ Line 17: / Line 17: @@
 ==References==
 * <ref name="ref1">
 Chen LQ, Hou BH, Lalonde S, Takanaga H, Hartung ML, et al. (2010) Sugar transporters for intercellular exchange and nutrition of pathogens. Nature 468: 527–532.
@@ Line 29: / Line 30: @@
 * <ref name="ref6">
 Krul WR, Colclasure GC (1977) Effect of galactose and other monosaccharides on IAA movement in bean hypocotyl segments. Physiol Plant 41: 249–253.
+</references>
 ==Structured Information==
 {{JaponicaGene|

@@ Line 1: / Line 1: @@
-MtN3 and saliva related transmembrane protein family protein gene.
+*Os05g0588500, also named '''OsSWEET5''', is a member of SWEETs, a MtN3 and saliva related transmembrane protein family<ref name="ref1" /><ref name="ref2" />.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*OsSWEET5 encodes a sugar transporter protein involved in galactose transport<ref name="ref3" />.
+*Overexpression of OsSWEET5 causes growth retardation, precocious senescence, galactose accumulation and disordered sugar distribution, results in the inhibition of auxin signaling and translocation<ref name="ref4" /><ref name="ref5" /><ref name="ref6" />.
-===Expression===
+*Knockout of OsSWEET5 causes no obvious phenotypes.
-===Evolution===
+===Expression Pattern===
-Please input evolution information here.
+*OsSWEET5 was mainly expressed in the floral organs at the heading stage, and was also detectable in stem, root and senescing leaves.
-You can also add sub-section(s) at will.
+===Subcellular Localization===
 ==Labs working on this gene==
-Please input related labs here.
+*National Key Laboratory of Crop Genetic Improvement and National Centre of Plant Gene Research, Huazhong Agricultural University, Wuhan, China.
 ==References==
-Please input cited references here.
+* <ref name="ref1">
 ==Structured Information==

← Older revision		Revision as of 13:21, 7 June 2014
Line 1:		Line 1:
−	~~Please input one-sentence summary here~~.	+	MtN3 and saliva related transmembrane protein family protein gene.

	==Annotated Information==		==Annotated Information==

← Older revision		Revision as of 20:15, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os05g0588500\|		GeneName = Os05g0588500\|