Os06g0110200 - Revision history

192.168.72.52: /* Structured Information */

2015-06-12T07:48:49Z

‎Structured Information

Zhangye at 02:41, 23 March 2015

2015-03-23T02:41:37Z

124.16.129.48 at 20:16, 22 July 2012

2012-07-22T20:16:29Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os06g0110200| Description = Late embryogenesis abundant (LEA) group 1 family protein| Version = NM_001063116.1 GI:115465963 GeneID:4339887| Leng..."

2012-06-24T09:00:07Z

Created page with "{{JaponicaGene| GeneName = Os06g0110200| Description = Late embryogenesis abundant (LEA) group 1 family protein| Version = NM_001063116.1 GI:115465963 GeneID:4339887| Leng..."

New page

{{JaponicaGene|
GeneName = Os06g0110200|
Description = Late embryogenesis abundant (LEA) group 1 family protein|
Version = NM_001063116.1 GI:115465963 GeneID:4339887|
Length = 554 bp|
Definition = Oryza sativa Japonica Group Os06g0110200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
AP = Chromosome 6:592578..593131|
CDS = 592662..592973|
GCID = <gbrowseImage1>
name=NC_008399:592578..593131
source=RiceChromosome06
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008399:592578..593131
source=RiceChromosome06
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcaggcggtgaaggagaaggtgaaggacaaggtgagcgcggtgaaggcgaaggggaaggtgagcaaggccaaggccgacgagaagaaggaggtggcgacggcgaggtcccacgccgagagggagctggcgcacgagcgcgctaaggccagggtcgccgccgccaagatggagctgcaccaggacaaggccctccaccgcgaggaggccatccagcacaggctccataagcatggcgccggaaccaccgccggcgttcgtccgaccgccgcggcgccggcgccgcacctcccacctgctagctactactag</cdnaseq>|
AA = <aaseq>MQAVKEKVKDKVSAVKAKGKVSKAKADEKKEVATARSHAERELA HERAKARVAAAKMELHQDKALHREEAIQHRLHKHGAGTTAGVRPTAAAPAPHLPPASY Y</aaseq>|
DNA = <dnaseqindica>85..396#atacgcactgcaagcttagcttggtgaggatcgatcgatcggagaagatcatcagattgataattaaagtaagaaaggtcgaggatgcaggcggtgaaggagaaggtgaaggacaaggtgagcgcggtgaaggcgaaggggaaggtgagcaaggccaaggccgacgagaagaaggaggtggcgacggcgaggtcccacgccgagagggagctggcgcacgagcgcgctaaggccagggtcgccgccgccaagatggagctgcaccaggacaaggccctccaccgcgaggaggccatccagcacaggctccataagcatggcgccggaaccaccgccggcgttcgtccgaccgccgcggcgccggcgccgcacctcccacctgctagctactactagtagctagtatgcacgcatgtctctctgtgctgctaattatcgtaacagtttccactaatcaatctacttacaataaataataagccagccagtgtgcatgtaatctgtactgtgtgccagacaagatatcagtgatatatctatcgaggttgttaatt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063116.1 RefSeq:Os06g0110200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 6]]
[[Category:Chromosome 6]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+'''''OsLEA4''''' is a '''late embryogenesis abundant''' (LEA) '''protein gene''' from rice<ref name="ref1"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*''OsLEA4'' is one of the '''important components in cellular glasses''' which '''may retain water molecules''', '''prevent crystallization''' of the cellular components, and '''stabilize desiccation-sensitive proteins''' as well as plasma membranes during dehydration. ''OsLEA4'' protein '''enhanced the tolerance''' of '''''E. coli''''' recombinant to '''high salinity''', '''heat''', '''freezing''', and '''UV radiation''', which suggested that OsLEA4 protein may play a '''protective role''' under stressed conditions<ref name="ref1"/>.
 ===Expression===
-Please input expression information here.
+*OsLEA4 protein '''contains a Pfam''':LEA_1 domain architecture at positions 1–73 with three α-helical domains and without β-sheet domain. OsLEA4 fusion protein could be '''expressed effectively''' and is soluble, which was concordant with the predicted result that OsLEA4 is hydrophilicity.
 ===Evolution===
-Please input evolution information here.
+*The '''sequence analysis''' indicated that the complete ORF of OsLEA4 cDNA is 312 bp and '''encodes a putative polypeptide''' of 103 amino acids with a calculated molecular mass of 11.19 kDa. The OsLEA4 '''polypeptide''' shows preponderance of Ala (22%), Lys (15%), Glu (9%), His (8%), Thr (8%), and Arg (7%) but depleted in Trp, Cys, Asn, and Phe residues. The OsLEA4 is a basic protein with a theoretical pI of 10.04, which is concordant with the high proportion of positive residues(29%)<ref name="ref1"/>.
-You can also add sub-section(s) at will.
+*LEA mRNAs and proteins can be induced to appear at other stages in the plant's life by desiccation stress and/or treatment with the plant hormone abscisic acid (ABA). A role in protecting plant structures during water loss is likely for these proteins, with ABA functioning in the stress transduction process. Presented here are conserved tracts of amino acid sequence among LEA proteins from several species that may represent domains functionally important in desiccation protection<ref name="ref4"/>.
 ==Labs working on this gene==
-Please input related labs here.
+*Key Laboratory of Biorheological Science and Technology, Ministry of Education, College of Bioengineering, Chongqing University, Chongqing 400044, People’s Republic of China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 20:16, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os06g0110200\|		GeneName = Os06g0110200\|

@@ Line 46: / Line 46: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]