Os06g0165600 - Revision history

Rice2012: /* Structured Information */

2015-06-12T08:07:30Z

‎Structured Information

Yimoukong: Undo revision 170736 by Yimoukong (talk)

2014-05-22T10:06:01Z

Undo revision 170736 by Yimoukong (talk)

Yimoukong: /* References */

2014-05-22T09:59:08Z

‎References

Yimoukong: /* References */

2014-05-22T09:57:10Z

‎References

Yimoukong: /* Labs working on this gene */

2014-05-22T09:53:29Z

‎Labs working on this gene

Yimoukong at 09:51, 22 May 2014

2014-05-22T09:51:26Z

Yimoukong at 09:36, 22 May 2014

2014-05-22T09:36:14Z

Yimoukong: /* Annotated Information */

2014-05-22T09:34:15Z

‎Annotated Information

Yimoukong at 09:33, 22 May 2014

2014-05-22T09:33:26Z

Yimoukong: /* References */

2014-05-22T09:32:55Z

‎References

@@ Line 68: / Line 68: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 59: / Line 59: @@
 ==References==
 <references>
-<ref name="ref1">Zhang Y, et al. (2009) Expression of a rice DREB1 gene, '''''OsDREB1D''''', enhances cold and high-salt tolerance in transgenic Arabidopsis. BMB reports 42(8):486-492.</ref>
+<ref name="ref1">Zhang Y, et al. (2009) Expression of a rice DREB1 gene, OsDREB1D, enhances cold and high-salt tolerance in transgenic Arabidopsis. BMB reports 42(8):486-492.</ref>
 <ref name="ref2">Dubouzet JG, et al. (2003) OsDREB genes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. The Plant journal : for cell and molecular biology 33(4):751-763.</ref>
 <ref name="ref3">Agarwal P, Agarwal P, Reddy MK, & Sopory S (2006) Role of DREB transcription factors in abiotic and biotic stress tolerance in plants. Plant Cell Rep 25(12):1263-1274.</ref>
 <ref name="ref4">Mao D & Chen C (2012) Colinearity and Similar Expression Pattern of Rice <italic>DREB1s</italic> Reveal Their Functional Conservation in the Cold-Responsive Pathway. PloS one 7(10):e47275.</ref>
-<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and '''''OsDREB1D'''''. Journal of Plant Biology 56(2):115-121.</ref>
+<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and OsDREB1D. Journal of Plant Biology 56(2):115-121.</ref>
 <ref name="ref6">Sakuma Y, et al. (2002) DNA-Binding Specificity of the ERF/AP2 Domain of Arabidopsis DREBs, Transcription Factors Involved in Dehydration- and Cold-Inducible Gene Expression. Biochemical and Biophysical Research Communications 290(3):998-1009.</ref>
 </references>

@@ Line 59: / Line 59: @@
 ==References==
 <references>
-<ref name="ref1">Zhang Y, et al. (2009) Expression of a rice DREB1 gene, OsDREB1D, enhances cold and high-salt tolerance in transgenic Arabidopsis. BMB reports 42(8):486-492.</ref>
+<ref name="ref1">Zhang Y, et al. (2009) Expression of a rice DREB1 gene, '''''OsDREB1D''''', enhances cold and high-salt tolerance in transgenic Arabidopsis. BMB reports 42(8):486-492.</ref>
 <ref name="ref2">Dubouzet JG, et al. (2003) OsDREB genes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. The Plant journal : for cell and molecular biology 33(4):751-763.</ref>
 <ref name="ref3">Agarwal P, Agarwal P, Reddy MK, & Sopory S (2006) Role of DREB transcription factors in abiotic and biotic stress tolerance in plants. Plant Cell Rep 25(12):1263-1274.</ref>
 <ref name="ref4">Mao D & Chen C (2012) Colinearity and Similar Expression Pattern of Rice <italic>DREB1s</italic> Reveal Their Functional Conservation in the Cold-Responsive Pathway. PloS one 7(10):e47275.</ref>
-<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and OsDREB1D. Journal of Plant Biology 56(2):115-121.</ref>
+<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and '''''OsDREB1D'''''. Journal of Plant Biology 56(2):115-121.</ref>
 <ref name="ref6">Sakuma Y, et al. (2002) DNA-Binding Specificity of the ERF/AP2 Domain of Arabidopsis DREBs, Transcription Factors Involved in Dehydration- and Cold-Inducible Gene Expression. Biochemical and Biophysical Research Communications 290(3):998-1009.</ref>
 </references>

@@ Line 58: / Line 58: @@
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

@@ Line 47: / Line 47: @@
 ==Labs working on this gene==
-Please input related labs here.
 ==References==

@@ Line 42: / Line 42: @@
 [[File:Evolution fig6.jpg|right|thumb|150px|Fig.6. Comparison of amino acid alignment of the DREB proteins.aDREB1-typeAhDREB1(AF274033), AtDREB1A(AB007787),
 AtDREB1B(AB007788), AtDREB1C(AB007789), CaDREBLP1(AY496155), OsDREB1A(AF300970), OsDREB1B(AF300972),OsDREB1C(AP001168), OsDREB1D(AB023482)(from reference<ref name="ref3" />)'']]
 <br>
 The DREB1/CBF1-type NLS consensus PKRPAGRTKFRETRHP distinguishes these proteins from other ERF/AP2 proteins. The DSAW motif at the end of the ERF/AP2 domain and LWSY motif at the end of the C-terminal are conserved in most of the DREB1-type proteins. Phylogenetic relationship among some of the reported DREB-type proteins is shown in Fig.7. <ref name="ref3" />.
@@ Line 48: / Line 47: @@
 ==Labs working on this gene==
-*College of Bioscience and Biotechnology, Yangzhou University, Yangzhou 225009, China
+Please input related labs here.
 ==References==
-<references>
+Please input cited references here.
 ==Structured Information==
 {{JaponicaGene|

← Older revision		Revision as of 09:36, 22 May 2014
Line 1:		Line 1:
−	~~Please input one-sentence summary here.~~
−
	Please input one-sentence summary here.		Please input one-sentence summary here.

@@ Line 1: / Line 1: @@
 Please input one-sentence summary here.
@@ Line 46: / Line 48: @@
 The DREB1/CBF1-type NLS consensus PKRPAGRTKFRETRHP distinguishes these proteins from other ERF/AP2 proteins. The DSAW motif at the end of the ERF/AP2 domain and LWSY motif at the end of the C-terminal are conserved in most of the DREB1-type proteins. Phylogenetic relationship among some of the reported DREB-type proteins is shown in Fig.7. <ref name="ref3" />.
 [[File:Evolution fig7.jpg|right|thumb|150px|Fig. 7. Relationships among some DREB proteins as illustrated by Tree View produced by DNA STAR, ClustalW. Scale indicates branch length. (from reference<ref name="ref3" />)'']]
 ==Labs working on this gene==

← Older revision		Revision as of 09:33, 22 May 2014
Line 65:		Line 65:
	<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and '''''OsDREB1D'''''. Journal of Plant Biology 56(2):115-121.</ref>		<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and '''''OsDREB1D'''''. Journal of Plant Biology 56(2):115-121.</ref>
	<ref name="ref6">Sakuma Y, et al. (2002) DNA-Binding Specificity of the ERF/AP2 Domain of Arabidopsis DREBs, Transcription Factors Involved in Dehydration- and Cold-Inducible Gene Expression. Biochemical and Biophysical Research Communications 290(3):998-1009.</ref>		<ref name="ref6">Sakuma Y, et al. (2002) DNA-Binding Specificity of the ERF/AP2 Domain of Arabidopsis DREBs, Transcription Factors Involved in Dehydration- and Cold-Inducible Gene Expression. Biochemical and Biophysical Research Communications 290(3):998-1009.</ref>
		+	==Structured Information==
		+	{{JaponicaGene\|
		+	GeneName = Os06g0165600\|
		+	Description = CRT/DRE binding factor (Transcription factor RCBF4)\|
		+	Version = NM_001063444.1 GI:115466619 GeneID:4340239\|
		+	Length = 904 bp\|
		+	Definition = Oryza sativa Japonica Group Os06g0165600, complete gene.\|
		+	Source = Oryza sativa Japonica Group
		+
		+	ORGANISM Oryza sativa Japonica Group
		+	Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
		+	Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
		+	clade; Ehrhartoideae; Oryzeae; Oryza.
		+	\|
		+	Chromosome = [[:category:Japonica Chromosome 6\|Chromosome 6]]\|
		+	AP = Chromosome 6:3309920..3310823\|
		+	CDS = 3309944..3310705\|
		+	GCID = <gbrowseImage1>
		+	name=NC_008399:3309920..3310823
		+	source=RiceChromosome06
		+	preset=GeneLocation
		+	</gbrowseImage1>\|
		+	GSID = <gbrowseImage2>
		+	name=NC_008399:3309920..3310823
		+	source=RiceChromosome06
		+	preset=GeneLocation
		+	</gbrowseImage2>\|
		+	CDNA = <cdnaseq>atggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtag</cdnaseq>\|
		+	AA = <aaseq>MEKNTAASGQLMTSSAEATPSSPKRPAGRTKFQETRHLVFRGVR WRGCAGRWVCKVRVPGSRGDRFWIGTSDTAEETARTHDAAMLALCGASASLNFADSAW LLHVPRAPVVSGLRPPAARCATRCLQGHRRVPAPGRGSTATATATSGDAASTAPPSAP VLSAKQCEFIFLSSLDCWMLMSKLISSSRAKGSLCLRKNPISFCMVTNSYTALLLEYI ILQMNSMIVLIHELSKYQVFLLLTMITHHLFQWRR</aaseq>\|
		+	DNA = <dnaseqindica>25..786#actgcttgagacgtcgcacacgtcatggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtaggcgcggacgccctcgccatcatcgtcgatgtcgccactgatgacgaggtccgcgccgctcaccagctcgcacgcctcgtcgtcgtccatgctcgccacctcggtccagcagctgaacc</dnaseqindica>\|
		+	Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063444.1 RefSeq:Os06g0165600]\|
		+	}}
		+	[[Category:Genes]]
		+	[[Category:Japonica mRNA]]
		+	[[Category:Oryza Sativa Japonica Group]]
		+	[[Category:Japonica Genes]]
		+	[[Category:Japonica Chromosome 6]]
		+	[[Category:Chromosome 6]]

← Older revision		Revision as of 09:32, 22 May 2014
Line 65:		Line 65:
	<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and '''''OsDREB1D'''''. Journal of Plant Biology 56(2):115-121.</ref>		<ref name="ref5">Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and '''''OsDREB1D'''''. Journal of Plant Biology 56(2):115-121.</ref>
	<ref name="ref6">Sakuma Y, et al. (2002) DNA-Binding Specificity of the ERF/AP2 Domain of Arabidopsis DREBs, Transcription Factors Involved in Dehydration- and Cold-Inducible Gene Expression. Biochemical and Biophysical Research Communications 290(3):998-1009.</ref>		<ref name="ref6">Sakuma Y, et al. (2002) DNA-Binding Specificity of the ERF/AP2 Domain of Arabidopsis DREBs, Transcription Factors Involved in Dehydration- and Cold-Inducible Gene Expression. Biochemical and Biophysical Research Communications 290(3):998-1009.</ref>
−
−	~~==Structured Information==~~
−	~~{{JaponicaGene\|~~
−	~~GeneName = Os06g0165600\|~~
−	~~Description = CRT/DRE binding factor (Transcription factor RCBF4)\|~~
−	~~Version = NM_001063444.1 GI:115466619 GeneID:4340239\|~~
−	~~Length = 904 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os06g0165600, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 6\|Chromosome 6]]\|~~
−	~~AP = Chromosome 6:3309920..3310823\|~~
−	~~CDS = 3309944..3310705\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008399:3309920..3310823~~
−	~~source=RiceChromosome06~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008399:3309920..3310823~~
−	~~source=RiceChromosome06~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtag</cdnaseq>\|
−	AA = <aaseq>MEKNTAASGQLMTSSAEATPSSPKRPAGRTKFQETRHLVFRGVR WRGCAGRWVCKVRVPGSRGDRFWIGTSDTAEETARTHDAAMLALCGASASLNFADSAW LLHVPRAPVVSGLRPPAARCATRCLQGHRRVPAPGRGSTATATATSGDAASTAPPSAP VLSAKQCEFIFLSSLDCWMLMSKLISSSRAKGSLCLRKNPISFCMVTNSYTALLLEYI ILQMNSMIVLIHELSKYQVFLLLTMITHHLFQWRR</aaseq>\|
−	DNA = <dnaseqindica>25..786#actgcttgagacgtcgcacacgtcatggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtaggcgcggacgccctcgccatcatcgtcgatgtcgccactgatgacgaggtccgcgccgctcaccagctcgcacgcctcgtcgtcgtccatgctcgccacctcggtccagcagctgaacc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063444.1 RefSeq:Os06g0165600]\|~~
−	}}
−	~~[[Category:Genes]]~~
−	~~[[Category:Japonica mRNA]]~~
−	~~[[Category:Oryza Sativa Japonica Group]]~~
−	~~[[Category:Japonica Genes]]~~
−	~~[[Category:Japonica Chromosome 6]]~~
−	~~[[Category:Chromosome 6]]~~