Os06g0612800 - Revision history

Xysj2017: /* Function */

2017-02-15T00:58:33Z

‎Function

Rice2012: /* Structured Information */

2015-06-12T08:19:21Z

‎Structured Information

Zhangye at 08:46, 15 January 2015

2015-01-15T08:46:33Z

124.16.129.48 at 20:25, 22 July 2012

2012-07-22T20:25:59Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os06g0612800| Description = Similar to PVPR3 protein| Version = NM_001064601.1 GI:115468933 GeneID:4341520| Length = 2123 bp| Definition = Oryz..."

2012-06-24T09:26:40Z

Created page with "{{JaponicaGene| GeneName = Os06g0612800| Description = Similar to PVPR3 protein| Version = NM_001064601.1 GI:115468933 GeneID:4341520| Length = 2123 bp| Definition = Oryz..."

New page

{{JaponicaGene|
GeneName = Os06g0612800|
Description = Similar to PVPR3 protein|
Version = NM_001064601.1 GI:115468933 GeneID:4341520|
Length = 2123 bp|
Definition = Oryza sativa Japonica Group Os06g0612800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
AP = Chromosome 6:25369000..25371122|
CDS = 25370061..25370576|
GCID = <gbrowseImage1>
name=NC_008399:25369000..25371122
source=RiceChromosome06
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008399:25369000..25371122
source=RiceChromosome06
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggagcacaaggagactggatgccagcagccagaaggcccgatcctttgcatcaataactgcggcttctttggcagtgcggctaccatgaacatgtgctcaaagtgccacaaggagatgataatgaagcaggagcaggccaagctggcagcctcctctatcgacagcattgtcaatggtggtgattccgggaaggaaccaattattgctggtcacgctgaagtagctgttgctcaagtcgaggtgaagacgcttgttgcgcagcctgctgagattgctggtcctagtgagggggtcacggtgaaccccaaggggagggaaggaccaaatcggtgctccacttgtcggaagagggttggtcttaccggattcaactgccgatgtggcaacttgtactgcgcaatgcaccgctattccgataagcatgactgccagtttgactatcggaccgctgctagggatgctattgccaaggctaatccggtggtgaaggcggagaaacttgacaaaatttag</cdnaseq>|
AA = <aaseq>MEHKETGCQQPEGPILCINNCGFFGSAATMNMCSKCHKEMIMKQ EQAKLAASSIDSIVNGGDSGKEPIIAGHAEVAVAQVEVKTLVAQPAEIAGPSEGVTVN PKGREGPNRCSTCRKRVGLTGFNCRCGNLYCAMHRYSDKHDCQFDYRTAARDAIAKAN PVVKAEKLDKI</aaseq>|
DNA = <dnaseqindica>1062..1577#atttcgaagcccaccgaattccattcctcgcgattcctctcccctcgcctcctcgtcctccccctcctagggttcgttcctactccctttcccccccccccccccgattcaatcgcgcctcgatctctcgcccccggtgctcctccctggccgatccgggatgctgttgatttgaggggttttcttttttcttttcttttcttttctttttcttgatggtttcttgatggggggttctgtgatgcagggatcgccggagaggaatcgcgcggaggaaaaaaaaagaaaagggcttcctcgtcgtctaaggttcgtggctcgattgcttccctgttcgatttatgattattattggtttaatttagcgtgttttttttcctttttccgcggtcaaaaggtgtgattttttttgatttgttgatttgatgtgtttggggttggggttgggtgtggaaggaacggcgatgagcggcgagcgaattcgggggaggtatggtgtaaaggcggtgttccctttacacgtattgggggtgtggttgttgcgcctagttgatggatggatgaatggatggatggcttctttggggcgctttgggcaaagtcagtgagcagatatggctgcaactttatggatttgttgctctgttgcgtaaagcggcgtaaagttgggagcctctttctagaaccaatatatatatatatcccctgctctctgatgttgttaggtaattagtctgttgggctagatagatttatagcaaggcaggttggactgttagtggtacatccacttttcttcggagttcttttacatgatgctttgctagagtgaaatttgacatgtatactatgcttcttgtttttgtcgcggtgtattttgcgcaatcaagaacatatgccatcattggcagatattgtctgctcagttttgctaccctgaagtggaacatttgattgtaatgcatttgcttttagagagtggaaaaatggaacctgtttttcttctttagtcttgtatttacgcattttttcttcttctgatttatagttaaaaggaagccatggagcacaaggagactggatgccagcagccagaaggcccgatcctttgcatcaataactgcggcttctttggcagtgcggctaccatgaacatgtgctcaaagtgccacaaggagatgataatgaagcaggagcaggccaagctggcagcctcctctatcgacagcattgtcaatggtggtgattccgggaaggaaccaattattgctggtcacgctgaagtagctgttgctcaagtcgaggtgaagacgcttgttgcgcagcctgctgagattgctggtcctagtgagggggtcacggtgaaccccaaggggagggaaggaccaaatcggtgctccacttgtcggaagagggttggtcttaccggattcaactgccgatgtggcaacttgtactgcgcaatgcaccgctattccgataagcatgactgccagtttgactatcggaccgctgctagggatgctattgccaaggctaatccggtggtgaaggcggagaaacttgacaaaatttaggggtttcatatggttggtgaacgaagcgtcacaatctgcggtcttcatcatccatctttgctgcattatccatgccttttcctttcatgttggctgctacaatctagttgttcggcatttgtgatgcatggcacaccacggcagcttcaagaaccctcatctctggtcagtccgaatggtttgcatgttggctatgttgtgtaagctttatttatgatcgtcttgcgctgacggtattgtggcttcgcatttagctagctctgtaatgtactattgtatccgaagtgttacattgcaaccagtaatagtaatcagcaatcgtccgttatatggtactgatgaccattcctgtgtgcagtacatctcaatcttctacatggtaaactctgggtgaggattcacaatatatatactacctggatatctcccacaaagacttgtttagaagtttaggtgacctggtgagaatgtggttctgtggttggtttgtgtaggctttggctttacctggatattatacactggaatatatacttttgcatgtgg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001064601.1 RefSeq:Os06g0612800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 6]]
[[Category:Chromosome 6]]

@@ Line 7: / Line 7: @@
 *This kind of upregulation of ''OsiSAP8'' within 30 min upon exposure to various stresses like  '''salinity''', '''drought''', '''desiccation''', '''cold''', '''submergence''', '''wounding''', '''heavy metals''' and '''ABA '''suggests that its product might be required during early phase of stress response. It may be argued that overexpression of ''OsiSAP8'' both in homologous and heterologous systems conferred tolerance to high salt, drought and cold stresses equally<ref name="ref1"/>.
-*It is found to be coding for a cytoplasmic zinc finger protein that might act early in the signal transduction of various stress responses. Its overexpression in both homologous (rice) and heterologous (tobacco) system lead to an increase in stress tolerance, as
+*It is found to be coding for a cytoplasmic zinc finger protein that might act early in the signal transduction of various stress responses. Its overexpression in both homologous (rice) and heterologous (tobacco) system lead to an increase in stress tolerance, as determined by salt-, drought-, and cold-tolerance assays. It was found that the chlorophyll retention, percentage germination, fresh weight, root and shoot elongation and leaf development were much better in rice transgenic lines, as compared to control plants, under stress and recovery conditions. However, the transgenic plants showed a yield penalty of 50% under unstressed conditions and the same yield was maintained under salt and drought stresses during anthesis, which is much better compared to no seed set in control stressed plants<ref name="ref1"/>.
 '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003677 GO:0003677], [http://amigo.geneontology.org/amigo/term/GO:0008270 GO:0008270]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+''OsiSAP8'', is a member of stress Associated protein(SAP) gene family from rice characterized by the presence of A20 and AN1 type Zinc finger domains<ref name="ref1"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*''OsiSAP8(Os06g0612800)'' is composed of three exons of 89, 62 and 1,088 bp separated by two introns of 176 and 739 bp, respectively. The introns were found in the 50UTR region and the coding region is continuous without any intron and is encoded exclusively by exon 3<ref name="ref1"/>.
 ===Expression===
-Please input expression information here.
+[[File: OsiSAP8 Expression1.jpg|right|thumb|300px|'''Figure 1.''' ''Expression pattern of ''OsiSAP8'' after different stresses to rice seedlings.(from reference <ref name="ref1"/>).'']]
 ===Evolution===
-Please input evolution information here.
+*The MtSAP1 protein sequence shared a strong homology with AtSAP7 and OsiSAP8 (54 and 62 %, respectively)<ref name="ref3"/>.
-You can also add sub-section(s) at will.
+*Based on the phylogenetic analysis of the AN1 zincfinger domains, ''Jin et al.''<ref name="ref6"/> recently divided all A20/AN1 zincfinger-containing SAP genes into two groups: Type I and Type II. Type I genes contain the traditional pattern of cysteine- and histidine-rich motifs, whereas Type II SAP genes contain the expanded domain CX4CX2CX9-12CX1-2CX4CX2HX5HXC where X represents any amino acid. Most Type I genes lack introns and contain one intact A20 type domain and/or one AN1 type zincfinger domain; most Type II genes have a single intron but do not contain an A20 domain<ref name="ref6"/><ref name="ref7"/>.
 ==Labs working on this gene==
-Please input related labs here.
+*Department of Plant Biotechnology, School of Biotechnology, Madurai Kamaraj University, Madurai 625021, TamilNadu, India
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 20:25, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os06g0612800\|		GeneName = Os06g0612800\|

@@ Line 85: / Line 85: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]