Os06g0706400 - Revision history

Rice2012: /* Structured Information */

2015-06-12T08:26:20Z

‎Structured Information

Shijc at 16:50, 30 December 2014

2014-12-30T16:50:05Z

Shijc at 16:49, 30 December 2014

2014-12-30T16:49:33Z

Shijc at 13:50, 27 December 2014

2014-12-27T13:50:36Z

124.16.129.48 at 20:28, 22 July 2012

2012-07-22T20:28:53Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os06g0706400| Description = Similar to Peptide transporter PTR2-B (Histidine transporting protein)| Version = NM_001188057.1 GI:297725244 GeneID:..."

2012-06-24T09:34:13Z

Created page with "{{JaponicaGene| GeneName = Os06g0706400| Description = Similar to Peptide transporter PTR2-B (Histidine transporting protein)| Version = NM_001188057.1 GI:297725244 GeneID:..."

New page

{{JaponicaGene|
GeneName = Os06g0706400|
Description = Similar to Peptide transporter PTR2-B (Histidine transporting protein)|
Version = NM_001188057.1 GI:297725244 GeneID:9268091|
Length = 2951 bp|
Definition = Oryza sativa Japonica Group Os06g0706400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
AP = Chromosome 6:30715316..30718266|
CDS = 30715362..30715418,30715623..30715722,30715952..30716253|
GCID = <gbrowseImage1>
name=NC_008399:30715316..30718266
source=RiceChromosome06
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008399:30715316..30718266
source=RiceChromosome06
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgtccacggacactgagcagcaggaacacgcagtggcgctgctacaacccgaggttgaagaagcatacaccactgatgggtctcttggcgtcgatggcaacccggcgctgaagcatcgcacaggcggatggatggcatgccgcccgattcttggcaccgagttctgctactgcctggcctactacggcatcacgttcaacctcgtcacctacctcaccgccgagctgcaccagagcaacgtcgccgccgccaacaacgtgtcgacgtggcaggccacctgcttcctcacgccgctggccggagccgtcgccgccgattcctactggggaaggtaccgcaccatggtcgtcagctgctgcatcggcgtcgctgttagtcccctccatttcattcgatccgggttgtgtttagttccaaattttttttttcaaacttctaactttccatcacattaa</cdnaseq>|
AA = <aaseq>MASTDTEQQEHAVALLQPEVEEAYTTDGSLGVDGNPALKHRTGG WMACRPILGTEFCYCLAYYGITFNLVTYLTAELHQSNVAAANNVSTWQATCFLTPLAG AVAADSYWGRYRTMVVSCCIGVAVSPLHFIRSGLCLVPNFFFQTSNFPSH</aaseq>|
DNA = <dnaseqindica>47..103#308..407#637..938#gattagcttgtacagtttgtcctcgagctctcgaccggctccggcaatggcgtccacggacactgagcagcaggaacacgcagtggcgctgctacaacccgaggtaattaattaatcgctgttcataatctccttactgctagccttatgccgatttccacgatgcagtttgtttaatttctcatcagtttccctgcagaaaaatattgattgagccttgcctgaactagctactcctagttaatttgaagcagccgctcatggatacgttcagtgctaactaggctggggattttggttgctgcaggttgaagaagcatacaccactgatgggtctcttggcgtcgatggcaacccggcgctgaagcatcgcacaggcggatggatggcatgccgcccgattcttggtaataaacttcattagatatccctgcagctctattaattatttcctaaccttttttacttgccaattttttgatgattaatgtgtctctcactttgtgtgttcttgttccaaaaaagaaaaaaatgaaaaaaaaaataaatgaggaacttctttgttgatgtggttatctgagctatgacaacactgaggagagatgcttattctgcttgctttgtgattgtggataggcaccgagttctgctactgcctggcctactacggcatcacgttcaacctcgtcacctacctcaccgccgagctgcaccagagcaacgtcgccgccgccaacaacgtgtcgacgtggcaggccacctgcttcctcacgccgctggccggagccgtcgccgccgattcctactggggaaggtaccgcaccatggtcgtcagctgctgcatcggcgtcgctgttagtcccctccatttcattcgatccgggttgtgtttagttccaaattttttttttcaaacttctaactttccatcacattaaatttttcatacacacaatttttttcagtcacgtcgtcttcaatttcaaccaaaatctaaactttataccaatctaaacacagccttaattagaattagtcactgtgtccttcctgccgtgaatttatggctgatggcaagtaatcagtcactgtgtgggatgtggatttttatcccttgagagaacatttaattttatattaatattaatttatgttaatttatgttgtcatttaattttatattttatattaatttatgttgtccattttttttaatttttttatgactaattagttggcatggatgaaacgagggatatttcctggagggatgaaatcactttccccactgtgtgctgccatgaatgcaaatccaatcagcttcatggctgtacgtacctaatctgtggtgcagggcatgctcatggcggctctgtcggcgcttctgccgctgctgatcaaggacacgtcgtccatggcttcagctcaagtgatcatcctgtttcttggcctgtacatgatcgcatttggggtgggtggtctccggccgtgcctgatgtccttcggcgccgaccagttcgacgacggcgacacgtcggagcgcatcagcaagggctcctacttcaactggtacatcttcaccatgaactgcgcgtccgtgatatccaccaccgccatggtgtgggtgcaagaccactacgggtgggcattggggttggggattccggcgatggtcctcgccgtcgggctctcctgccttgtcgccgcgtctcgggcgtacaggtttcagacaacccgcggtagcccgctcaccagagtctgccaggtcgtcgtcgccgccgtccgcaagttcaacgtcgcgccgccggccgacatggcccttctctacgacctatcggaggatgcctcctccatgaagggagttcagaggatcgagcacaccgccgatctccggtcagttcatgtctctcgttgcatctggtgtttgtgatgctgtaggtgtaatgtaattggctaattcttgagatgcaactgctcgatcagattcttcgacaaggccgccgtcgtgacggcgtcggacgaggaggcggagggcgccgcgccgcgcaatccatggaggctttgcgtggtgacgcaggtggaggagctcaagattctcgtcaggatgctgcccctgtgggcgtgcgtcgccttctactacaccgcgacggcgcaggccaattcgacgttcgtcgagcagggcatggcgatggacacgcgcgtcggctccttccacgtcccgccggcatccctggccaccttccagatcatcaccacgatcgtgttgatcccgctgtacgaccgcgcgttcgtgccggcggcgaggaggctgacggggagagagaagggcatctccgaccttctcaggatcggcggcggcctcgccatggccgcgctcgccatggccgcggcggcgctggtcgagacgaggcgcgcccgcgcggcgcacgccgggatggagccgacgagcatcctgtggcaggcgccgcagtacgtgctggtgggcgtcggcgagctgctcgccaccgtggggcagctggacttcttctacagccaggcgccgccggccatgaagacggtgtgcacggcgctcgggttcatctccgtcgcggcgggggagtacctgagctcgctcgtcgtgacggccgtgtcgtgggcgacggcgaccggcggccggccggggtggatccccgacgacctcaacgaggggcacctgatcgcttcttctggatgatggctgggctcggttgcctcaatcttgtggtgtttacgagctgtgccatgaggtacaaatccaggaaggcctgttgatacttctgggcttgtttggtaggctcgaaattccggcccatgcactctgacgggccattatgtatgggaataagtccatccgacctccctcatctcttgcacttggtcgaatcgcatccctcagccgcaaaaaactgggtaaaacgcctcctgaatctccc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001188057.1 RefSeq:Os06g0706400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 6]]
[[Category:Chromosome 6]]

@@ Line 5: / Line 5: @@
 [[File: Shijc-Os06g0706400-Fig1.png|right|thumb|200px|'' The effect of OsPTR9 on the formation of roots. (from reference <ref name="ref1" />).'']]
 '''OsPTR9 expression is regulated by light and N source'''
 OsPTR9 is closely related to the functional di/tripeptide transporters <ref name="ref2" /> and is localized at the plasma membrane. Members of the PTR/NRT1 family transport a wide range of substrates, including di/tripeptides, nitrate, histidine, carboxylates, other N-containing compounds such as IAA-amino acid conjugates, ABA, glutathione, and even the defence compound glucosinolate, and other substrate compounds might be identified <ref name="ref3" /><ref name="ref4" /><ref name="ref5" /><ref name="ref6" /><ref name="ref7" /><ref name="ref2" />.
 OsPTR9 was found to be expressed in all organs analysed, but expression levels varied. The expression of OsPTR9 was high at night and low during the light period, which is different than the expression patterns of many ammonium and nitrate transporter genes <ref name="ref8" /><ref name="ref9" />. Inorganic N is usually used for metabolic synthesis in Arabidopsis under light, but organic N is usually used for long-distance transport and substance storage under dark conditions <ref name="ref10" />. Therefore, OsPTR9 might also be an organic N transporter. Similar to AMT1;3 <ref name="ref11" />, but different from other inorganic N transporters, OsPTR9 expression also affected root growth. The expression of OsPTR9 was repressed during N starvation and induced by ammonium, similar to the expression induction of the ammonium transporter OsAMT1;2 <ref name="ref12" />. The regulation of OsPTR9-expression by N sources and light/dark changes shows that there are common feedback regulatory pathways for C/N balance in rice, similar to reports from studies of Arabidopsis <ref name="ref13" /><ref name="ref14" />.
 [[File: Shijc-Os06g0706400-Fig2.png|right|thumb|200px|'' Root architecture is affected by altered expression of OsPTR9. (from reference <ref name="ref1" />).'']]
 '''The effect of OsPTR9 on the development of roots and stems may contribute to nutrient uptake and allocation'''
 Biomass and photosynthesis rate differed most between altered-OsPTR9 expressing plants and the wild type, when ammonium or nitrate was the sole N source other than nitrate. Ammonium is the preferred N species taken up by rice <ref name="ref15" />. Root development is strongly affected by the plant's nutritional status and by the external availability of nutrients <ref name="ref16" /><ref name="ref17" />. Ammonium is complementary to nitrate in shaping lateral root development and, in Arabidopsis, the stimulation of lateral root branching by ammonium occurs in an AMT1;3-dependent manner <ref name="ref11" />. Increased expression of OsPTR9 promoted the growth of lateral roots, while a lower number of lateral roots were found in the osptr9 mutant and the OsPTR9-RNAi lines, suggesting that OsPTR9 contributes to ammonium-stimulated lateral root branching. In maize seedlings, the time required for the entire cap to be displaced by a new set of cells ranges from 24 h to 7 days, depending on growth conditions <ref name="ref18" />. Abnormal cell displacement of the root cap in the osptr9 mutant and the OsPTR9-RNAi lines might block root growth into soil, while the thickened cell wall of the osptr9 mutant and the OsPTR9-RNAi lines may hinder lateral root formation leading to reduced root surface area for N uptake. Dense cytoplasm accumulated in the cortical fibre cells of the OsPTR9-RNAi lines and the osptr9 mutant, which might suggest a transportation obstacle due to the down-expression of OsPTR9 leading to cytoplasm accumulation in cells on the outside of the cortex.
 Rice roots in paddy soil prefer ammonium as the N source <ref name="ref15" />, and the major N forms in the xylem sap of rice plants are Gln and Asn <ref name="ref19" />. Down-regulation of OsPTR9 expression caused decreased concentrations of some amino acids in roots and leaves, while many amino acids accumulated in stems. These might be caused by the abnormal development of the stem, which resulted in short and slim plants, and a reduced and disordered arrangement of the outer vascular bundle. These may, finally, block N translocation from source organs (leaves and roots) to sink (seed) resulting in nutrient accumulation in the stems and a reduced number of filled seeds. Generally, N partitioning to leaves positively regulates photosynthesis and consequently improves allocation of carbohydrates to sink tissues for vegetative and reproductive growth <ref name="ref20" />. The changed levels and partitioning of amino acids and proteins might lead to the observed growth effects and reduced N translocation to seeds.
 '''N recycling from leaves is important for increased grain yields in OsPTR9-over-expressing plants'''
 The leaves are sinks for N during the vegetative stage; subsequently, this N is remobilized to the developing seeds. Up to 80% of grain N contents are derived from leaves in rice and wheat <ref name="ref21" /> <ref name="ref22" /> <ref name="ref23" />. The high transport rate of amino acids is an essential prerequisite for seed development. Down-regulation of OsPTR9 resulted in higher concentrations of amino acids in the stems, suggesting that OsPTR9 directly or indirectly affected the transport of amino acids to seeds. Over-expression of OsPTR9 also promoted ammonium uptake, which might be the reason for the up-regulation of OsAMT1;2 expression in the OsPTR9-over-expressing lines, as OsAMT1;2 expression was shown to be induced by ammonium <ref name="ref12" />.

@@ Line 4: / Line 4: @@
 ===Function===
 [[File: Shijc-Os06g0706400-Fig1.png|right|thumb|200px|'' The effect of OsPTR9 on the formation of roots. (from reference <ref name="ref1" />).'']]
-‘’’OsPTR9 expression is regulated by light and N source’’’
+'''OsPTR9 expression is regulated by light and N source'''
 OsPTR9 is closely related to the functional di/tripeptide transporters <ref name="ref2" /> and is localized at the plasma membrane. Members of the PTR/NRT1 family transport a wide range of substrates, including di/tripeptides, nitrate, histidine, carboxylates, other N-containing compounds such as IAA-amino acid conjugates, ABA, glutathione, and even the defence compound glucosinolate, and other substrate compounds might be identified <ref name="ref3" /><ref name="ref4" /><ref name="ref5" /><ref name="ref6" /><ref name="ref7" /><ref name="ref2" />.
 OsPTR9 was found to be expressed in all organs analysed, but expression levels varied. The expression of OsPTR9 was high at night and low during the light period, which is different than the expression patterns of many ammonium and nitrate transporter genes <ref name="ref8" /><ref name="ref9" />. Inorganic N is usually used for metabolic synthesis in Arabidopsis under light, but organic N is usually used for long-distance transport and substance storage under dark conditions <ref name="ref10" />. Therefore, OsPTR9 might also be an organic N transporter. Similar to AMT1;3 <ref name="ref11" />, but different from other inorganic N transporters, OsPTR9 expression also affected root growth. The expression of OsPTR9 was repressed during N starvation and induced by ammonium, similar to the expression induction of the ammonium transporter OsAMT1;2 <ref name="ref12" />. The regulation of OsPTR9-expression by N sources and light/dark changes shows that there are common feedback regulatory pathways for C/N balance in rice, similar to reports from studies of Arabidopsis <ref name="ref13" /><ref name="ref14" />.
 [[File: Shijc-Os06g0706400-Fig2.png|right|thumb|200px|'' Root architecture is affected by altered expression of OsPTR9. (from reference <ref name="ref1" />).'']]
-‘’’The effect of OsPTR9 on the development of roots and stems may contribute to nutrient uptake and allocation’’’
+'''The effect of OsPTR9 on the development of roots and stems may contribute to nutrient uptake and allocation'''
 Biomass and photosynthesis rate differed most between altered-OsPTR9 expressing plants and the wild type, when ammonium or nitrate was the sole N source other than nitrate. Ammonium is the preferred N species taken up by rice <ref name="ref15" />. Root development is strongly affected by the plant's nutritional status and by the external availability of nutrients <ref name="ref16" /><ref name="ref17" />. Ammonium is complementary to nitrate in shaping lateral root development and, in Arabidopsis, the stimulation of lateral root branching by ammonium occurs in an AMT1;3-dependent manner <ref name="ref11" />. Increased expression of OsPTR9 promoted the growth of lateral roots, while a lower number of lateral roots were found in the osptr9 mutant and the OsPTR9-RNAi lines, suggesting that OsPTR9 contributes to ammonium-stimulated lateral root branching. In maize seedlings, the time required for the entire cap to be displaced by a new set of cells ranges from 24 h to 7 days, depending on growth conditions <ref name="ref18" />. Abnormal cell displacement of the root cap in the osptr9 mutant and the OsPTR9-RNAi lines might block root growth into soil, while the thickened cell wall of the osptr9 mutant and the OsPTR9-RNAi lines may hinder lateral root formation leading to reduced root surface area for N uptake. Dense cytoplasm accumulated in the cortical fibre cells of the OsPTR9-RNAi lines and the osptr9 mutant, which might suggest a transportation obstacle due to the down-expression of OsPTR9 leading to cytoplasm accumulation in cells on the outside of the cortex.
 Rice roots in paddy soil prefer ammonium as the N source <ref name="ref15" />, and the major N forms in the xylem sap of rice plants are Gln and Asn <ref name="ref19" />. Down-regulation of OsPTR9 expression caused decreased concentrations of some amino acids in roots and leaves, while many amino acids accumulated in stems. These might be caused by the abnormal development of the stem, which resulted in short and slim plants, and a reduced and disordered arrangement of the outer vascular bundle. These may, finally, block N translocation from source organs (leaves and roots) to sink (seed) resulting in nutrient accumulation in the stems and a reduced number of filled seeds. Generally, N partitioning to leaves positively regulates photosynthesis and consequently improves allocation of carbohydrates to sink tissues for vegetative and reproductive growth <ref name="ref20" />. The changed levels and partitioning of amino acids and proteins might lead to the observed growth effects and reduced N translocation to seeds.
-‘’’N recycling from leaves is important for increased grain yields in OsPTR9-over-expressing plants’’’
+'''N recycling from leaves is important for increased grain yields in OsPTR9-over-expressing plants'''
 The leaves are sinks for N during the vegetative stage; subsequently, this N is remobilized to the developing seeds. Up to 80% of grain N contents are derived from leaves in rice and wheat <ref name="ref21" /> <ref name="ref22" /> <ref name="ref23" />. The high transport rate of amino acids is an essential prerequisite for seed development. Down-regulation of OsPTR9 resulted in higher concentrations of amino acids in the stems, suggesting that OsPTR9 directly or indirectly affected the transport of amino acids to seeds. Over-expression of OsPTR9 also promoted ammonium uptake, which might be the reason for the up-regulation of OsAMT1;2 expression in the OsPTR9-over-expressing lines, as OsAMT1;2 expression was shown to be induced by ammonium <ref name="ref12" />.

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+OsPTR9 affects nitrogen utilization efficiency, growth and grain yield in rice. <ref name="ref1" />
 ==Annotated Information==
 ===Function===
-Please input function information here.
+[[File: Shijc-Os06g0706400-Fig1.png|right|thumb|200px|'' The effect of OsPTR9 on the formation of roots. (from reference <ref name="ref1" />).'']]
-===Expression===
+‘’’N recycling from leaves is important for increased grain yields in OsPTR9-over-expressing plants’’’
-Please input expression information here.
+The leaves are sinks for N during the vegetative stage; subsequently, this N is remobilized to the developing seeds. Up to 80% of grain N contents are derived from leaves in rice and wheat <ref name="ref21" /> <ref name="ref22" /> <ref name="ref23" />. The high transport rate of amino acids is an essential prerequisite for seed development. Down-regulation of OsPTR9 resulted in higher concentrations of amino acids in the stems, suggesting that OsPTR9 directly or indirectly affected the transport of amino acids to seeds. Over-expression of OsPTR9 also promoted ammonium uptake, which might be the reason for the up-regulation of OsAMT1;2 expression in the OsPTR9-over-expressing lines, as OsAMT1;2 expression was shown to be induced by ammonium <ref name="ref12" />.
-===Evolution===
+===Mutation===
-Please input evolution information here.
+[[File: Shijc-Os06g0706400-Fig3.png|right|thumb|200px|'' Phenotypes of rice plants with altered expression of OsPTR9. (from reference <ref name="ref1" />).'']]
-You can also add sub-section(s) at will.
+===Expression===
 ==Labs working on this gene==
-Please input related labs here.
+. Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, Chinese Academy of Sciences, Guangzhou, China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 20:28, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os06g0706400\|		GeneName = Os06g0706400\|

@@ Line 69: / Line 69: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]