Os07g0492000 - Revision history

Xysj2027 at 14:59, 6 May 2017

2017-05-06T14:59:52Z

Xysj2027 at 14:58, 6 May 2017

2017-05-06T14:58:44Z

Xysj1981: /* References */

2017-03-08T06:09:07Z

‎References

Aibyly: /* Function */

2014-06-09T15:45:13Z

‎Function

Aibyly: /* References */

2014-06-09T15:44:16Z

‎References

Aibyly: /* References */

2014-06-09T15:43:15Z

‎References

Aibyly: /* Expression */

2014-06-09T15:41:57Z

‎Expression

Aibyly at 15:35, 9 June 2014

2014-06-09T15:35:09Z

124.16.129.48 at 20:36, 22 July 2012

2012-07-22T20:36:21Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os07g0492000| Description = Nucleoside diphosphate kinase I (EC 2.7.4.6) (NDK I) (NDP kinase I) (NDPK I)| Version = NM_001066217.1 GI:115472166 G..."

2012-06-24T08:36:33Z

Created page with "{{JaponicaGene| GeneName = Os07g0492000| Description = Nucleoside diphosphate kinase I (EC 2.7.4.6) (NDK I) (NDP kinase I) (NDPK I)| Version = NM_001066217.1 GI:115472166 G..."

New page

{{JaponicaGene|
GeneName = Os07g0492000|
Description = Nucleoside diphosphate kinase I (EC 2.7.4.6) (NDK I) (NDP kinase I) (NDPK I)|
Version = NM_001066217.1 GI:115472166 GeneID:4343275|
Length = 2484 bp|
Definition = Oryza sativa Japonica Group Os07g0492000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
AP = Chromosome 7:18995155..18997638|
CDS = 18995452..18995569,18996011..18996242,18997223..18997271,18997470..18997520|
GCID = <gbrowseImage1>
name=NC_008400:18995155..18997638
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008400:18995155..18997638
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctgattggagacatcatcagcaggttcgagaagaaaggattctacctgagggggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttag</cdnaseq>|
AA = <aaseq>MEQSFIMIKPDGVQRGLIGDIISRFEKKGFYLRGMKFMNVERSF AQQHYADLSDKPFFPGLVEYIISGPVVAMVWEGKDVVATGRRIIGATRPWEAAPGTIR ADYAVEVGRNVIHGSDSVDNGKKEIALWFPEGLAEWRSNLHPWIYES</aaseq>|
DNA = <dnaseqindica>2070..2187#1397..1628#368..416#119..169#actccgcctcgcctccactcctctcctctccgcatcctcctcatcgcctccgcttctgcttttttttttcttttttctcgttgatcggtttgttcgatcagatcggttctttggagagatggagcagtccttcatcatgatcaagcctgacggcgtccagagaggcctggtaatctgacttctttttttcttttaatgttcttcttgtcgttttggccatcgattttcgagaggaattttgcggtttcggatcggttaaatagcgtagttgattggtgtttgtttgtgagattttgagttgttttggtaactttttgtaccgttttgcgtggtttttaatggggaattttgattttctgttctgcagattggagacatcatcagcaggttcgagaagaaaggattctacctgaggggtatggctgatccttttcccctctcgatttgatcgtatggattcatttttcataactttcttttgtatttttattgatctaattttgggttgacctacccgtttttttcaacacatattatgaaaagcagaggctgacgatatcataatactctgtttcatatgggtaggttggggttgtgagttgtgacatggagaatttgatgggtttaatacatgattcaaaagcaagatttttttatataatttatatgttgatgattggccatttttaactggggacaacagactgacacagtaatattcaatttagtatatcaactgattcgttgtcaagtctaattttgcattacatgacatgggcaacttatttattattatagcagagatcgtcaaagcctcaaagatgtagtctactatttgtacttgtaatcatggaaatatctttctgaaaagaaaacatcatttgtacttgcaatagagttcaactaatatctttggcatgcatttaacgtgctcttttccattttttgttccttattaaaagttgttgtactttagtggaaaccaaaatgttttataaagcattacagaacaacaaaaacagctgtcttaaggaacagcaacaaagaacagaagtaaaggactttcatttaacttcccctgtttataacaactgtgtagccatgtattggttgatgtggcgattataacaactgtgaagcccatttttatgagaattattcgaaatgcacgcaaaacatcatccaaaaacttaatttcatttaacttcccctgtttaagaaatatacttcctccattccaaactataagcatttatgcgtgttattcacaatgaatctcgatcttgagattcattctgaaaaacaagtataaatgctttttattttggaacggaggtaatattcggttgagggatgatggtgcttacgaattactttttgaactgcaatgatccagggatgaagttcatgaatgtggagaggtcctttgcacagcagcactatgccgacctttccgacaagcccttcttccctgggttggtggagtacatcatctctggccccgtcgttgcgatggtttgggaagggaaggatgttgttgccactggccgcaggatcattggggccaccaggccctgggaggcagcccccggcaccatccgtgctgactatgccgtggaagttggcaggtgagtcattcttgtctgtcttggtcatcagctcattattgcttgaattttcagtcagttcttgtgatccttttaatcatgtaaggatcctgagcgatggatggttctttatttgttttgctgctagcatcaaacgatgattttgtttgaaaatgggtggttaagtggcttttattttgatctatataaatgtgtgaacctctgttttttaccagtcagaaggtatcagatagtgaatgtgctgtgatatgatttacaaaaacttttgcatgcattatgatgttcatcttttctatatgttacgatgttagtgtatttagacataataactacttggattatgttaaactatgttcaattctagcttttgtttttgaaaataaaaatcataatgcttcctgcttatcgatgcctaagctcaagctgttgtttcttgtgtaggaatgtcatccatgggagcgactccgtggacaacgggaagaaggagatcgctctctggttccctgaaggtttagctgagtggaggagcaaccttcacccttggatctatgagtcttagagcttcgcgcctataatcgatcacctcttggtggctagttctcgttaaatatttgagttttgtttcagagttgtcatctggctgcctcctgagtcaccattataattctgctgtgatacaatcacagttatatgttgcctgaacttatatggctttttaagtttctggattggatgtgatgggaaaataatactagcagtcagtttttgcttataaatgtcgtaatatcttaatcatgctctttccctaggttcatccaagataagcagatggtgttgcctgattttcttgtggcac</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066217.1 RefSeq:Os07g0492000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

@@ Line 6: / Line 6: @@
 ===Function===
-* Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.  <ref name="ref1" />
+* Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.  <ref name="ref1" /><ref name="ref2" />
 * The enzyme is involved in and required for coleoptile elongation in rice as the level of the rice NDK (rNDK) changes during seed germination and the early stages of seedling growth.

@@ Line 1: / Line 1: @@
-Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.
+The rice '''''Os07g0492000''''' was reported as '''''NDK1''''' in (2005) <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
 ===Function===
-. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice  <ref name="ref1" />
+* Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.  <ref name="ref1" />
-. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens <ref name="ref2" />
+* The enzyme is involved in and required for coleoptile elongation in rice as the level of the rice NDK (rNDK) changes during seed germination and the early stages of seedling growth.
 ===Expression===
-Transcripts of OsNDPK1 accumulated strongly after infection with Xoo. When rice plants were infected with Burkholderia glumae, a bacterial grain/seedling rot pathogen, the pattern of expression of the rice NDPK genes was similar to that following infection with Xoo. OsNDPK1 gene expression was also strongly induced in response to exposure to salicylic acid, jasmonic acid, and abscisic acid, although the level of transcripts and their pattern of expression depended on the inducer.
+* The expression of rice NDK gene is up-regulated in the growing coleoptiles when the anaerobic stress persists.
 ===Evolution===
-When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).
+* When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Agricultural Plant Stress Research Center, Applied Plant Science Division, College of Agriculture and Life Sciences, Chonnam
+* Biology Group, Research Division, National Synchrotron Radiation Research Center, Hsinchu 30076, Taiwan
-National University, Gwangju 500-757, Korea;
+* Department of Life Sciences and Structural Biology Program, National Tsing-Hua University, Hsinchu 30076, Taiwan
 ==References==

@@ Line 23: / Line 23: @@
 <ref name="ref1">Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318.</ref>
 <ref name="ref2"> Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.</ref>
+</references>
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice
+. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice  <ref name="ref1" />
-. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens
+. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens <ref name="ref2" />
 ===Expression===

@@ Line 20: / Line 20: @@
 ==References==
 <ref name="ref1">Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice (< i> Oryza sativa</i> L.)[J]. Journal of structural biology, 2005, 150(3): 309-318.</ref>
 <ref name="ref2"> Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.</ref>

← Older revision		Revision as of 20:36, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os07g0492000\|		GeneName = Os07g0492000\|