Os07g0556800 - Revision history

Xysj2012: /* Structured Information */

2015-06-12T08:44:39Z

‎Structured Information

Zhangye at 02:26, 13 January 2015

2015-01-13T02:26:55Z

Zhangye at 09:08, 12 January 2015

2015-01-12T09:08:54Z

Zhangye: /* Knowledge Extension */

2015-01-12T08:52:30Z

‎Knowledge Extension

Zhangye: /* Evolution */

2015-01-12T08:51:17Z

‎Evolution

Zhangye: /* Expression */

2015-01-12T08:42:23Z

‎Expression

Zhangye at 08:40, 12 January 2015

2015-01-12T08:40:05Z

124.16.129.48 at 20:38, 22 July 2012

2012-07-22T20:38:14Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os07g0556800| Description = Ribosome-inactivating protein family protein| Version = NM_001066499.1 GI:115472730 GeneID:4343572| Length = 1037 bp..."

2012-06-24T08:41:20Z

Created page with "{{JaponicaGene| GeneName = Os07g0556800| Description = Ribosome-inactivating protein family protein| Version = NM_001066499.1 GI:115472730 GeneID:4343572| Length = 1037 bp..."

New page

{{JaponicaGene|
GeneName = Os07g0556800|
Description = Ribosome-inactivating protein family protein|
Version = NM_001066499.1 GI:115472730 GeneID:4343572|
Length = 1037 bp|
Definition = Oryza sativa Japonica Group Os07g0556800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
AP = Chromosome 7:22882458..22883494|
CDS = 22882542..22883438|
GCID = <gbrowseImage1>
name=NC_008400:22882458..22883494
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008400:22882458..22883494
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaa</cdnaseq>|
AA = <aaseq>MVKPAAVLLLLYLPLLATPTRIGLSRNPFVPPPNSVPTIDRTEM DVSTSPYRDLIKKWRDLVLLNTRPEVMVPEDHPVLAPQYDDTVPPERLLLPKLVANGD KTATLALRDSNIYFIGFANKAGQWFSFKDRNDLPPSFRARPLSFGVDYASIAGFRKNL PNYPLGRRQTEWAVKVLSEYDPNRTDEATIKRAVVIILLTFCEALRFFPIRNAVEIGW DSVAYITSTDADRLVCWGQISYMLEYSFMSGHSWDSEEQRTRLKNLARDCKIFNEPQA LETVDVLEYGAILGAKSTNWLY</aaseq>|
DNA = <dnaseqindica>57..953#aaaaaaagcccaaaccttcaagttcacctttgcttaattgcaccagcttagccgtcatggtgaagcctgcagccgtcctcctgctcctctaccttccccttctcgccaccccgacgaggatcggcctcagccgcaaccccttcgtccctcctcccaactctgtacctaccatagacaggacggagatggacgtgagcacgtcgccgtaccgcgacttgatcaagaaatggcgagacctcgtgctcctcaacactcgcccggaggtcatggtgccggaagaccatccggtgctggctccccagtacgacgacaccgtcccgccggaacggttgctgttgccgaagctggtggccaacggggacaagacggccacgctcgccctccgcgactccaacatctacttcataggtttcgccaacaaagcagggcaatggttctctttcaaggacaggaacgacctgccgccttcctttcgggccaggcctctcagctttggagtggactacgcatcgatcgccggcttccggaaaaaccttccaaactaccctctcggtaggcgtcaaacggagtgggcggtaaaagttctttcagaatacgatccaaatcgcactgatgaagcaaccataaaacgtgcggtagtgatcatccttcttaccttctgcgaagctctcaggttctttcctataagaaatgcggttgaaataggttgggactccgttgcctacattacctcaaccgatgcggatcgtctcgtatgttggggacaaatctcatatatgcttgaatatagttttatgtccggtcattcatgggactcggaggaacaacgtactcgcctcaagaatctagcacgagattgtaaaatctttaacgaacctcaggcacttgaaaccgttgatgtgttagagtacggagctatcttaggtgctaaaagtacaaattggttgtattaatgcaaggtgtaagcgccctcctagctaatataggcgcacttccacaatttatgtactccaatattatgcaactcacatggtgtg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066499.1 RefSeq:Os07g0556800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

@@ Line 9: / Line 9: @@
 *''OSRIP18'' and other rice RIP genes may be potentially useful for developing new plant varieties with higher tolerance to various stresses<ref name="ref2"/>.
-'''GO assignment(s):''' GO:0017148, GO:0030598
+'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0017148 GO:0017148], [http://amigo.geneontology.org/amigo/term/GO:0030598 GO:0030598]
 ===Mutation===
 transgenic lines<ref name="ref1"/>:

@@ Line 9: / Line 9: @@
 *''OSRIP18'' and other rice RIP genes may be potentially useful for developing new plant varieties with higher tolerance to various stresses<ref name="ref2"/>.
-'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0017148 GO:0017148], [http://amigo.geneontology.org/amigo/term/GO:0030598 GO:0030598]
+'''GO assignment(s):''' GO:0017148, GO:0030598
 ===Mutation===

← Older revision		Revision as of 08:52, 12 January 2015
Line 52:		Line 52:

	===Knowledge Extension===		===Knowledge Extension===
		+	[[File: RIPs Classification.jpg\|bottom\|thumb\|300px\|'''Figure 3.'''''Classification of RIPs.(from reference <ref name="ref6"/>).'']]

		+	*Only type 1 RIP genes are present in rice genome and some of them might have evolved into pseudogenes since they show no expression under normal growth conditions or various environmental stresses. Expression analyses showed that some members of rice RIP family might play important roles in biotic stressrelated biological processes and function as a regulator of various environmental cues and hormone signaling<ref name="ref2"/>.
		+
		+	*Ribosome-inactivating proteins (RIPs) either single-chain (type 1) or two-chain (type 2) are frequent in plants, often in multiple forms. They are RNA N-glycosidases, have antiviral, antifungal and insecticidal activity. Their expression in plants is increased under stressful conditions<ref name="ref5"/>.
		+
		+	RIPs are investigated for practical applications in medicine and in agriculture. In medicine, RIPs have been linked to, or fused with, appropriate antibodies or other carriers to form "immunotoxins" or other conjugates specifically toxic to the cells target of the carrier, with the aim of eliminating malignant or other undesired cells. In agriculture, it has been observed that an enhanced expression of RIPs confers to plants an increased resistance to viruses, fungi, insects, and also to drought and salinity<ref name="ref5"/>.
		+
		+	*RIPs are classified into two main classes according to their structure, namely holo-RIPs and chimero-RIPs. This classification system is illustated in Figure 3. Holo-RIPs comprise the RIPs that consist of a N-glycosylase domain only and usually consist of one chain, while chimero-RIPs are proteins made up of two domains. The class of the holo-RIPs contains two types of RIPs: one-chain type-1 RIPs and two-chain type-1 RIPs<ref name="ref6"/>.

	==Labs working on this gene==		==Labs working on this gene==

@@ Line 37: / Line 37: @@
 *The transgenic plants over-expressing ''OSRIP18'' showed no obvious phenotype difference during vegetative or reproductive development stages under normal growth conditions. This gene was induced by PEG and high salinity treatments during panicle development<ref name="ref1"/><ref name="ref2"/>.
-===Evolution===
+[[File: OSRIP18 Phylogenetic1.jpg|left|thumb|250px|'''Figure 2.'''''Phylogenetic analysis and classification of genes encoding RIP domain proteins in rice and other plants.(from reference <ref name="ref2"/>).'']]
-Please input evolution information here.
+Evolution of the RIP family<ref name="ref2"/>:
-You can also add sub-section(s) at will.
+. To classify the family members and explore their evolutionary relationships, the amino acid sequences from RIP domains of all rice members and some members from other species were used for sequence alignment and a phylogenetic tree was constructed based on these aligned sequences (Fig. 2).<br>
 ===Knowledge Extension===

@@ Line 20: / Line 20: @@
 ===Expression===
-Please input expression information here.
+[[File: OSRIP18 transgenic1.jpg|right|thumb|270px|'''Figure 1.'''''Phenotypic characterization of transgenic plants overexpressing OSRIP18.(from reference <ref name="ref1"/>).'']]
 ===Evolution===

@@ Line 88: / Line 88: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+''Oryza sativa Ribosome-inactivating protein gene 18 (OSRIP18)'' may be potentially useful in further improving plant tolerance to various abiotic stresses by over-expression<ref name="ref1"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*''OSRIP18(Os07g0556800)'' might play a role in increasing tolerance to drought and high salinity during panicle development but not in seedling stage. After overexpression, active expression can be detected in all tested developmental stages and as a result, the transgenic plants exhibited higher tolerance to both stresses in these stages<ref name="ref1"/>. It means the gene may play a role as a member of natural defense system against various environmental conditions including drought and high salinity stresses<ref name="ref2"/>.
 ===Expression===
@@ Line 12: / Line 26: @@
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+*Rice Functional Genomics Group, Temasek Life Sciences Laboratory, 1 Research Link, The National University of Singapore, Singapore 117604, Singapore
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 20:38, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os07g0556800\|		GeneName = Os07g0556800\|