Os08g0167500 - Revision history

Rice2012: /* Structured Information */

2015-06-12T09:27:52Z

‎Structured Information

Puhua001: CHLORORESPIRATORY REDUCTION 6 (CRR6) play a role in photorespiration in ''Orazy sativa''（Yamori et al. 2011）.

2014-06-07T14:46:39Z

CHLORORESPIRATORY REDUCTION 6 (CRR6) play a role in photorespiration in ''Orazy sativa''（Yamori et al. 2011）.

Puhua001: CHLORORESPIRATORY REDUCTION 6 (CRR6) 对叶绿体NAD(P)H 脱氢酶(NDH)复合体的亚复合物 A 的聚集是必需的（Yamori et al. 2011）。

2014-06-07T14:30:25Z

CHLORORESPIRATORY REDUCTION 6 (CRR6) 对叶绿体NAD(P)H 脱氢酶(NDH)复合体的亚复合物 A 的聚集是必需的（Yamori et al. 2011）。

124.16.129.48 at 20:45, 22 July 2012

2012-07-22T20:45:05Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os08g0167500| Description = Conserved hypothetical protein| Version = NM_001067614.1 GI:115474964 GeneID:4344752| Length = 2049 bp| Definition ..."

2012-06-21T12:48:35Z

Created page with "{{JaponicaGene| GeneName = Os08g0167500| Description = Conserved hypothetical protein| Version = NM_001067614.1 GI:115474964 GeneID:4344752| Length = 2049 bp| Definition ..."

New page

{{JaponicaGene|
GeneName = Os08g0167500|
Description = Conserved hypothetical protein|
Version = NM_001067614.1 GI:115474964 GeneID:4344752|
Length = 2049 bp|
Definition = Oryza sativa Japonica Group Os08g0167500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
AP = Chromosome 8:3948087..3950135|
CDS = 3948167..3948377,3949066..3949200,3949289..3949497,3949605..3949811|
GCID = <gbrowseImage1>
name=NC_008401:3948087..3950135
source=RiceChromosome08
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008401:3948087..3950135
source=RiceChromosome08
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccgccaccgcactccaactcccagtggccagctcgcaacgtctgacgctgaggcgtttccccggcagcggctcgttgggtcggtactctgggttgcggtggcccgtcgcggcgcaggcgaggagggcggcggaggaggggtttcgtctccgtgtcgcgttcaacccctccgggaacttcgacctctccctctccaccgaccaagacgatgccccacaagttgagcctccaccaccacctacagaaggtcgctttgagattgtcatcaacaccgatatcatccggacgctcgacctttcgcctgttcatgaagtacttggtgacttgaattccctgacaccagctcaaacaagaaatctcttggatcgaacggtcgggtttactataaactatgagagggaggatccatatgatgtgagggagctgtcagagttccctgatataaggctatggtttgtgaggcttgatgcttgttacccttggttccctgttgtgcttgattggagagctggtgaacttgccagatatgccgcaatgctggcccctcaccagatgagcatgaggcttggtgtggtcttcaacccggaggcgctggagctgtttgtgatgaagaaggtgttcattgtttactcatggctaaagcagcaggaacatcctaaacctggactcaagacggctgacatggccaggatgcttggtttcggtataggagatgaattattcgacttgattgagaagtatcctgctggtccttcatga</cdnaseq>|
AA = <aaseq>MAATALQLPVASSQRLTLRRFPGSGSLGRYSGLRWPVAAQARRA AEEGFRLRVAFNPSGNFDLSLSTDQDDAPQVEPPPPPTEGRFEIVINTDIIRTLDLSP VHEVLGDLNSLTPAQTRNLLDRTVGFTINYEREDPYDVRELSEFPDIRLWFVRLDACY PWFPVVLDWRAGELARYAAMLAPHQMSMRLGVVFNPEALELFVMKKVFIVYSWLKQQE HPKPGLKTADMARMLGFGIGDELFDLIEKYPAGPS</aaseq>|
DNA = <dnaseqindica>81..291#980..1114#1203..1411#1519..1725#gttgcgtctcccgccgcggtgacctcacctctcttcctcgccgccggcggccgcgcgtccatcgcgtcgccgtcgccgccatggccgccaccgcactccaactcccagtggccagctcgcaacgtctgacgctgaggcgtttccccggcagcggctcgttgggtcggtactctgggttgcggtggcccgtcgcggcgcaggcgaggagggcggcggaggaggggtttcgtctccgtgtcgcgttcaacccctccgggaacttcgacctctccctctccaccgaccaagacggtgagcgactaggagtaaaaactactgccaatttggaaataaatttctccatggagagcggttgaaaaccaaaattccgtattttattcagttttgtgtttgagtttgaaaactatataattttctgtagtaagacaatactactgacttgtttttttttcttccattgctaactattacagtgcaccgtcaatctgctacatatgagtatctgactgagatgattgactcttagtgaagttacatcaaccatcacagttgataaccatcgcagttgatgtgcaaattgcaagaatactaatcttgttatgactaaaacatttgagcttttcactcaatcgtttgattcagtcaaagatgttctcaaacttcaattgcatgggagggatgtggcttggaaatgcctaattaaccacagggtggttcatttatgtgaaaccctgtttattggttgctagaggttccctgaagggtaaaagttgttattatgcttgaaacaaagcaagggtggaagtgattttatttcttcatgctgggttgacctcatgttacctagtaaaatttgttacaattaaaactttatttgttgcctatcagtcgttctgtgtgtataatatgcacctgttccttgatttggtaaatccatttcttttgcttgcaaatgacaatcttcgacggcttgctgtagatgccccacaagttgagcctccaccaccacctacagaaggtcgctttgagattgtcatcaacaccgatatcatccggacgctcgacctttcgcctgttcatgaagtacttggtgacttgaattccctgacaccaggtgcgcaacaatgaaagtcatgacattgtattgtttcaacagtcaattccatgttatagttaacaagaatcttatgtgtatcattcagctcaaacaagaaatctcttggatcgaacggtcgggtttactataaactatgagagggaggatccatatgatgtgagggagctgtcagagttccctgatataaggctatggtttgtgaggcttgatgcttgttacccttggttccctgttgtgcttgattggagagctggtgaacttgccagatatgccgcaatgctggcccctcaccaggtaacaagatataacctgaattttgcatccccaaataatttggtcctacatatacttccatgtcgttttggagtttaagatgaattcatatttgcaaaaatctgcagatgagcatgaggcttggtgtggtcttcaacccggaggcgctggagctgtttgtgatgaagaaggtgttcattgtttactcatggctaaagcagcaggaacatcctaaacctggactcaagacggctgacatggccaggatgcttggtttcggtataggagatgaattattcgacttgattgagaagtatcctgctggtccttcatgaatctatctccataacctagagaattttgtcaataataggcatcacatcatacctttttcttttttttttaagcatcacccggggcgaaatgctcacctgaatatggattacatcatactgaatcaaatgataactgttttcagtcgtctgggctttgctatatgttgttgttgtctacaggaaacaattcaatgtgtaaatagtgccaaagaaatcaaattttagctcaggagtacagtttgagattttgcttctggtgctagtaactttgtaagctcctgcaactgtgatatgaatataattttgccactaacgccttgcttg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067614.1 RefSeq:Os08g0167500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 8]]
[[Category:Chromosome 8]]

@@ Line 32: / Line 32: @@
    The Plant Journal, 2011, 68(6): 966-976
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 1: / Line 1: @@
 The rice gene Os08g0167500 was reported as CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex, is essential for photorespiration in ''Orazy sativa Japonica Group''.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+  The role of NAD(P)H dehydrogenase (NDH)‐dependent cyclic electron flow around photosystem I in photosynthetic regulation and plant growth at several temperatures was examined in rice (Oryza sativa) that is defective in CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex (crr6). NdhK was not detected by Western blot analysis in crr6 mutants, resulting in lack of a transient post‐illumination increase in chlorophyll fluorescence, and confirming that crr6 mutants lack NDH activity. When plants were grown at 28 or 35°C, all examined photosynthetic parameters, including the CO2 assimilation rate and the electron transport rate around photosystems I and II, at each growth temperature at light intensities above growth light (i.e. 800 μmol photons m−2 sec−1), were similar between crr6 mutants and control plants. However, when plants were grown at 20°C, all the examined photosynthetic parameters were significantly lower in crr6 mutants than control plants, and this effect on photosynthesis caused a corresponding reduction in plant biomass. The Fv/Fm ratio was only slightly lower in crr6 mutants than in control plants after short‐term strong light treatment at 20°C. However, after long‐term acclimation to the low temperature, impairment of cyclic electron flow suppressed non‐photochemical quenching and promoted reduction of the plastoquinone pool in crr6 mutants. Taken together, our experiments show that NDH‐dependent cyclic electron flow plays a significant physiological role in rice during photosynthesis and plant growth at low temperature.
 The role of NAD(P)H dehydrogenase (NDH)‐dependent cyclic electron flow around photosystem I in photosynthetic regulation and plant growth at several temperatures was examined in rice (Oryza sativa) that is defective in CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex (crr6). NdhK was not detected by Western blot analysis in crr6 mutants, resulting in lack of a transient post‐illumination increase in chlorophyll fluorescence, and confirming that crr6 mutants lack NDH activity. When plants were grown at 28 or 35°C, all examined photosynthetic parameters, including the CO2 assimilation rate and the electron transport rate around photosystems I and II, at each growth temperature at light intensities above growth light (i.e. 800 μmol photons m−2 sec−1), were similar between crr6 mutants and control plants. However, when plants were grown at 20°C, all the examined photosynthetic parameters were significantly lower in crr6 mutants than control plants, and this effect on photosynthesis caused a corresponding reduction in plant biomass. The Fv/Fm ratio was only slightly lower in crr6 mutants than in control plants after short‐term strong light treatment at 20°C. However, after long‐term acclimation to the low temperature, impairment of cyclic electron flow suppressed non‐photochemical quenching and promoted reduction of the plastoquinone pool in crr6 mutants. Taken together, our experiments show that NDH‐dependent cyclic electron flow plays a significant physiological role in rice during photosynthesis and plant growth at low temperature.
 ===Expression===
-Please input expression information here.
+  Rice crr6 mutants do not accumulate the NDH complex. CRR6 is a stromal protein that is required for the assembly of NDH sub-complex A in Arabidopsis (Peng et al., 2010), and is encoded by a single-copy gene (Os08g0167500) in rice. The Tos17 retrotransposon was inserted into the exon of this gene (OsCRR6). Homozygous Tos17 insertion plants were identified by PCR analysis from progeny of a heterozygous plant provided by the National Institute of Agrobiological Sciences of Japan. As Tos17 mutant lines may include multiple insertions in a single genome, the crr6 mutant plant was crossed with the wild-type, and the resulting plants containing the homo-zygous wild-type CRR6 allele were used as control plants (+/+) in the experiments described below . As the control plants behaved like wild-type plants in all experi-ments, we describe differences between crr6 mutants and the control plants (+/+). The fact that the TOS17 insertioncaused the mutant phenotype was further confirmed in the generation (see below).
-Rice crr6 mutants do not accumulate the NDH complex. CRR6 is a stromal protein that is required for the assembly of NDH sub-complex A in Arabidopsis (Peng et al., 2010), and is encoded by a single-copy gene (Os08g0167500) in rice. The Tos17 retrotransposon was inserted into the exon of this gene (OsCRR6). Homozygous Tos17 insertion plants were identified by PCR analysis from progeny of a heterozygous plant provided by the National Institute of Agrobiological Sciences of Japan. As Tos17 mutant lines may include multiple insertions in a single genome, the crr6 mutant plant was crossed with the wild-type, and the resulting plants containing the homo-zygous wild-type CRR6 allele were used as control plants (+/+) in the experiments described below . As the control plants behaved like wild-type plants in all experi-ments, we describe differences between crr6 mutants and the control plants (+/+). The fact that the TOS17 insertioncaused the mutant phenotype was further confirmed in the generation (see below).
+  Immunoblot analysis showed that CRR6 was not present in crr6 mutants (Figure 1c). The chloroplast NDH complex is divided into four parts (the A, B, membrane and lumen sub-complexes; Peng et al., 2008, 2011), and CRR6 is required for accumulation of subcomplex A in Arabidopsis (Peng et al.,2008). To study the effect of disruption of CRR6 on accumu-lation of the NDH complex in rice, we assessed the level of NdhK, a subunit of sub-complex A of the NDH complex, in crr6 mutants (Figure 1c). The NdhK level was drastically reduced to below the detection limit in crr6 mutants. Thus,consistent with observations in Arabidopsis (Peng et al.,2010), accumulation of NDH sub-complex A was impaired in rice crr6 mutants.
-Immunoblot analysis showed that CRR6 was not present in crr6 mutants (Figure 1c). The chloroplast NDH complex is divided into four parts (the A, B, membrane and lumen sub-complexes; Peng et al., 2008, 2011), and CRR6 is required for accumulation of subcomplex A in Arabidopsis (Peng et al.,2008). To study the effect of disruption of CRR6 on accumu-lation of the NDH complex in rice, we assessed the level of NdhK, a subunit of sub-complex A of the NDH complex, in crr6 mutants (Figure 1c). The NdhK level was drastically reduced to below the detection limit in crr6 mutants. Thus,consistent with observations in Arabidopsis (Peng et al.,2010), accumulation of NDH sub-complex A was impaired in rice crr6 mutants.
+*mRNA and Protein(s)
 ===Evolution===
-Please input evolution information here.
+  Gene ID: 4344752
-Gene ID: 4344752
+  Gene symbol:Os08g0167500
-Gene symbol:Os08g0167500
+  Gene description:Os08g0167500
-Gene description:Os08g0167500
+  Gene type:protein coding
-Gene type:protein coding
+  RefSeq status:PROVISIONAL
-RefSeq status:PROVISIONAL
+  Organism:Oryza sativa Japonica Group (cultivar: Nipponbare)
-Organism:Oryza sativa Japonica Group (cultivar: Nipponbare)
+  Lineage:Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
 ==Labs working on this gene==
-Please input related labs here.
+  Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Aoba-ku, Sendai 981-8555, Japan
-Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Aoba-ku, Sendai 981-8555, Japan
+  Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto 606-8502, Japan
 ==References==
    Wataru Yamori;Naoki Sakata;Yuji Suzuki;Toshiharu Shikanai;Amane Makino
    Cyclic electron flow around photosystem I via chloroplast NAD(P)H dehydrogenase (NDH) complex performs a significant physiological role during photosynthesis and plant growth at low temperature in rice

@@ Line 1: / Line 1: @@
 Please input one-sentence summary here.
+The rice gene Os08g0167500 was reported as CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex, is essential for photorespiration in ''Orazy sativa Japonica Group''.
 ==Annotated Information==
 ===Function===
 Please input function information here.
+The role of NAD(P)H dehydrogenase (NDH)‐dependent cyclic electron flow around photosystem I in photosynthetic regulation and plant growth at several temperatures was examined in rice (Oryza sativa) that is defective in CHLORORESPIRATORY REDUCTION 6 (CRR6), which is required for accumulation of sub‐complex A of the chloroplast NDH complex (crr6). NdhK was not detected by Western blot analysis in crr6 mutants, resulting in lack of a transient post‐illumination increase in chlorophyll fluorescence, and confirming that crr6 mutants lack NDH activity. When plants were grown at 28 or 35°C, all examined photosynthetic parameters, including the CO2 assimilation rate and the electron transport rate around photosystems I and II, at each growth temperature at light intensities above growth light (i.e. 800 μmol photons m−2 sec−1), were similar between crr6 mutants and control plants. However, when plants were grown at 20°C, all the examined photosynthetic parameters were significantly lower in crr6 mutants than control plants, and this effect on photosynthesis caused a corresponding reduction in plant biomass. The Fv/Fm ratio was only slightly lower in crr6 mutants than in control plants after short‐term strong light treatment at 20°C. However, after long‐term acclimation to the low temperature, impairment of cyclic electron flow suppressed non‐photochemical quenching and promoted reduction of the plastoquinone pool in crr6 mutants. Taken together, our experiments show that NDH‐dependent cyclic electron flow plays a significant physiological role in rice during photosynthesis and plant growth at low temperature.
 ===Expression===
 Please input expression information here.
+Rice crr6 mutants do not accumulate the NDH complex. CRR6 is a stromal protein that is required for the assembly of NDH sub-complex A in Arabidopsis (Peng et al., 2010), and is encoded by a single-copy gene (Os08g0167500) in rice. The Tos17 retrotransposon was inserted into the exon of this gene (OsCRR6). Homozygous Tos17 insertion plants were identified by PCR analysis from progeny of a heterozygous plant provided by the National Institute of Agrobiological Sciences of Japan. As Tos17 mutant lines may include multiple insertions in a single genome, the crr6 mutant plant was crossed with the wild-type, and the resulting plants containing the homo-zygous wild-type CRR6 allele were used as control plants (+/+) in the experiments described below . As the control plants behaved like wild-type plants in all experi-ments, we describe differences between crr6 mutants and the control plants (+/+). The fact that the TOS17 insertioncaused the mutant phenotype was further confirmed in the generation (see below).
 ===Evolution===
 Please input evolution information here.
+Gene ID: 4344752
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
 Please input related labs here.
+Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Aoba-ku, Sendai 981-8555, Japan
 ==References==
 Please input cited references here.
+  Wataru Yamori;Naoki Sakata;Yuji Suzuki;Toshiharu Shikanai;Amane Makino
 ==Structured Information==
 {{JaponicaGene|

← Older revision		Revision as of 20:45, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os08g0167500\|		GeneName = Os08g0167500\|