Os08g0504700 - Revision history

Rice2012: /* Structured Information */

2015-06-12T09:32:36Z

‎Structured Information

Zhangye at 14:21, 5 March 2015

2015-03-05T14:21:40Z

124.16.129.48 at 20:52, 22 July 2012

2012-07-22T20:52:26Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os08g0504700| Description = Similar to Multiple stress-responsive zinc-finger protein ISAP1 (Stress- associated protein 1) (OsISAP1)| Version = N..."

2012-06-21T13:07:05Z

Created page with "{{JaponicaGene| GeneName = Os08g0504700| Description = Similar to Multiple stress-responsive zinc-finger protein ISAP1 (Stress- associated protein 1) (OsISAP1)| Version = N..."

New page

{{JaponicaGene|
GeneName = Os08g0504700|
Description = Similar to Multiple stress-responsive zinc-finger protein ISAP1 (Stress- associated protein 1) (OsISAP1)|
Version = NM_001068716.1 GI:115477169 GeneID:4345973|
Length = 983 bp|
Definition = Oryza sativa Japonica Group Os08g0504700, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|
AP = Chromosome 8:25041942..25042924|
CDS = 25042010..25042522|
GCID = <gbrowseImage1>
name=NC_008401:25041942..25042924
source=RiceChromosome08
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008401:25041942..25042924
source=RiceChromosome08
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgcagagggagaagaaggtggaggagccgacggagctgagggcgccggagatgacgctctgcgccaacagctgcgggttcccgggcaacccggcgaccaacaacctctgccagaactgcttcttggctgcctcggcgtcttcttcttcttcttccgccgctgcctcgccgtcgacgacgtcgttgccggtgtttccggtggtggagaagccgaggcaggccgtacagtcgtcggcggcggcggcggtggcgctggtggttgagcggccgacggcggggccggtggagtcgtcgtcgaaggcgtcgaggtcgtcgtcggtcaaccgatgccacagctgccggaggcgggtgggcctgaccgggttccggtgccgctgcggcgagctctactgcggcgcgcaccggtactccgaccgccacgactgcagcttcgactacaagtcggcggcgagggacgccatcgccagggagaaccccgtcgtccgcgccgccaagatcgttaggttctaa</cdnaseq>|
AA = <aaseq>MAQREKKVEEPTELRAPEMTLCANSCGFPGNPATNNLCQNCFLA ASASSSSSSAAASPSTTSLPVFPVVEKPRQAVQSSAAAAVALVVERPTAGPVESSSKA SRSSSVNRCHSCRRRVGLTGFRCRCGELYCGAHRYSDRHDCSFDYKSAARDAIARENP VVRAAKIVRF</aaseq>|
DNA = <dnaseqindica>69..581#gcctcgctaacccattcccaaaagcaaagcgaacctaagctcgcttcgtctctctctcggattcgatcatggcgcagagggagaagaaggtggaggagccgacggagctgagggcgccggagatgacgctctgcgccaacagctgcgggttcccgggcaacccggcgaccaacaacctctgccagaactgcttcttggctgcctcggcgtcttcttcttcttcttccgccgctgcctcgccgtcgacgacgtcgttgccggtgtttccggtggtggagaagccgaggcaggccgtacagtcgtcggcggcggcggcggtggcgctggtggttgagcggccgacggcggggccggtggagtcgtcgtcgaaggcgtcgaggtcgtcgtcggtcaaccgatgccacagctgccggaggcgggtgggcctgaccgggttccggtgccgctgcggcgagctctactgcggcgcgcaccggtactccgaccgccacgactgcagcttcgactacaagtcggcggcgagggacgccatcgccagggagaaccccgtcgtccgcgccgccaagatcgttaggttctaaaaggataatacaaggggaaaccaacctgaattttcctccttttttctttcttttttcttcttctttccttttaaaaattaaagttgagggtattattttttcttttcctgagagcttcttaaaggtgaaaggggaaaaaaaagaaagaaaaagaaaaggagatgagatgggtgactcaagatgcatcaagcaaaggaagaacaatatgatgatgatgatgttgttgttgtagtggtggttgaggttggaagttggatggaaagagggaggaaggaagaagatggggttgttgtgttgtcctcccacaaatctctatttaattttaattcccttttgtataaaatttattattatctgtggagagcattattatcagcttgagctagtggcatctttcttttt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001068716.1 RefSeq:Os08g0504700]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 8]]
[[Category:Chromosome 8]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+'''''OsSAP11''''' confers abiotic stress tolerance in rice<ref name="ref1"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+[[File: OsSAP11 Cloning1.jpg|left|thumb|300px|'''Figure 1.''' ''Cloning and overexpression of OsSAP11 and OsRLCK253 genes in Arabidopsis plants.(from reference <ref name="ref1"/>).'']]
 ===Expression===
-Please input expression information here.
+*There were only '''six SAP genes''' (''OsSAP1'', ''OsSAP9'', ''OsSAP11'', ''OsSAP12'', ''OsSAP14'' and ''OsSAP17''), which showed '''significant increase''' in expression upon exposure to '''cold stress'''<ref name="ref2"/>.
 ===Evolution===
-Please input evolution information here.
+It was found that the A20 domain mediates the interaction of ''OsSAP1'' with self, its '''close homolog OsSAP11''' and a rice receptor-like cytoplasmic kinase, ''OsRLCK253''<ref name="ref1"/>.
-You can also add sub-section(s) at will.
+*Based on the phylogenetic analysis of the AN1 zincfinger domains, ''Jin et al.''<ref name="ref4"/> recently divided all A20/AN1 zincfinger-containing SAP genes into two groups: Type I and Type II. Type I genes contain the traditional pattern of cysteine- and histidine-rich motifs, whereas Type II SAP genes contain the expanded domain CX4CX2CX9-12CX1-2CX4CX2HX5HXC where X represents any amino acid. Most Type I genes lack introns and contain one intact A20 type domain and/or one AN1 type zincfinger domain; most Type II genes have a single intron but do not contain an A20 domain<ref name="ref4"/><ref name="ref5"/>.
 ==Labs working on this gene==
-Please input related labs here.
+*Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi 110021, India
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 20:52, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os08g0504700\|		GeneName = Os08g0504700\|

@@ Line 68: / Line 68: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]