Os10g0167600 - Revision history

Rice2012: /* References */

2015-06-13T08:45:16Z

‎References

Lmw2015: /* Structured Information */

2015-06-12T03:28:18Z

‎Structured Information

Liyingshu: /* Evolution */

2014-06-09T16:04:55Z

‎Evolution

Liyingshu: /* Expression */

2014-06-09T16:04:09Z

‎Expression

Liyingshu: /* Expression */

2014-06-09T16:03:02Z

‎Expression

Liyingshu: /* Function */

2014-06-09T15:58:22Z

‎Function

Liyingshu: /* Annotated Information */

2014-06-09T15:55:31Z

‎Annotated Information

Liyingshu: /* Function */

2014-06-09T15:40:14Z

‎Function

Liyingshu: /* Evolution */

2014-06-09T15:36:28Z

‎Evolution

Liyingshu: /* Expression */

2014-06-09T15:35:50Z

‎Expression

← Older revision		Revision as of 08:45, 13 June 2015
Line 79:		Line 79:
	[[Category:Japonica Chromosome 10]]		[[Category:Japonica Chromosome 10]]
	[[Category:Chromosome 10]]		[[Category:Chromosome 10]]
		+	== Structured Information ==

← Older revision		Revision as of 03:28, 12 June 2015
Line 73:		Line 73:


−	~~==Structured Information==~~
−	~~{{JaponicaGene\|~~
−	~~GeneName = Os10g0167600\|~~
−	~~Description = Similar to CPD photolyase\|~~
−	~~Version = NM_001189112.1 GI:297727354 GeneID:9272017\|~~
−	~~Length = 3900 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os10g0167600, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 10\|Chromosome 10]]\|~~
−	~~AP = Chromosome 10:4343782..4347681\|~~
−	~~CDS = 4343990..4344169,4344287..4344358,4344993..4345074,4345697..4345755,4345844..4345880<br>,4346001..4346035\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008403:4343782..4347681~~
−	~~source=RiceChromosome10~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008403:4343782..4347681~~
−	~~source=RiceChromosome10~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgctgctgataaaagagagcatatctatacgtgagagggaacagcttgagaatgccaaaacacatgatcctttgtggaatgcatcgcagttggagatggttcaccatggaaaaatgcatggattcatgagaatgtactgggccaaaaagattctagaatggactagtggaccagaagaagcactttcaactgcaatttatttaaatgacaagtatgagatagatggcagggaccccagtggttacgtcggatgtatgtggtccatatgtggcctccatgatcagggttggaaggagcgtccagtatttggaaagatacgttacatgaattacgctggctgcaagagaaaattcgatgttgacgcttacatttcttatgtcaagagattagctggtcaatccaagaagaggaacgctgaggagtctccaaatcctgtagtcaagctttccaagtctcagcactaa</cdnaseq>\|
−	AA = <aaseq>MLLIKESISIREREQLENAKTHDPLWNASQLEMVHHGKMHGFMR MYWAKKILEWTSGPEEALSTAIYLNDKYEIDGRDPSGYVGCMWSICGLHDQGWKERPV FGKIRYMNYAGCKRKFDVDAYISYVKRLAGQSKKRNAEESPNPVVKLSKSQH</aaseq>\|
−	DNA = <dnaseqindica>3513..3692#3324..3395#2608..2689#1927..1985#1802..1838#1647..1681#aattcacacccacaaacgcacgcccgcacgcgcgcgcgcgcgctcagagacctccgtcgccgcccgccgcacgccggcgacccaccgcgccgcacgatgccgccgacctcagtgagcccaccaagaacagcgccggggccggcgaacccgagcccggcacacccgtcccgcgtgcgggtgatccacccgggcggcgggaagcccggtgggccggtggtgtactggatgctgcgggaccagcggctcgccgacaactgggcgctcctccacgccgccggcctcgccgccgcctccgcgtccccgctcgccgtcgcgttcgcgctgttcccgaggcccttcctcctctccgcccgccgccgccagctcgggttcctcctccgcggcctccgccgcctcgccgccgacgccgccgcccgccacctccccttcttcctcttcaccggtacgcgcccttttctttttctttttctttttctttttcttttgtctccatccgtgacgatgacatgtgggccaccccgtcttgcgaaatgtgacgtggctttttctctggctcgctgacaggtgggcccgcggagatcccggcgctggtgcggcgccttggtgcgtcgacgctggtcgccgacttctcgccgctgcggccggtgagggaggcgctcgacgcggtggtcggcgacctgcggcgggaggcgcccggcgtggccgtgcaccaggtgagcgtggtggcattgctgtttgcatcaatcttccaagaaagttgggaatctttttggggatggataatgaattcgccggagaatttagagattcttgtggaattcttcgaatgcaggtggacgcgcacaacgtggtgcctgtgtggacggcgtcggcgaagatggagtattcagccaagaccttcagaggcaaggtgagcaaggtgatggatgagtaccttgtggagttccctgaattgccggcggtggtgccatgggacagggagcagccggagggggtcgactgggacgcactcatcgccagggtttgcaggtgcggatgataattctaaggtgtattgggtggtaattttgtttgtgtagatatggatgactattgattcttggttgtttgagcagtgaggcggagaatgtgccggagattgactggtgtgagcctggagaggaagcagccatagaggcgcttctcggcagcaaggatggattcctgacgaagaggatcaagagctatgaaactgaccggaatgatcccacgaaaccacgggcattgtctgggctttcaccataccttcattttgggcacatttcggcacagcggtgtgcgctcgaggcaaagaaatgccgacatcttagtcccaaggtgctgttctttaactgatttgttatgattaaaagagttatgatcctcttgcaatgtaataaattgttagatggcattgtttttctttaccgtgaactggctagaattcttagtgatgttgtttacctaatagatgtttgaagtaacatgtgttctgaaacagtccgtcgatgctttcttggaggaattggttgtaaggagggaattagctgacaacttctgctattaccaacctcaatatgattcgctgtctggtgcatgggaatgggcaaggaagacactgatggatcatgctgctgataaaagagagcatatctatacgtgagtaagttgccctttataatttattgtcacaattttaaccaaattatcttcctgacgatgttaaggtaaaagatcttcgctctaattggttatttgttaattgtcattttgttttggctaggagggaacagcttgagaatgccaaaacacatgatcctgtaagtgctattggacgtggtgtactctgttgctgatattgaagttactctaacacactgagttattttttttctaaatgattatcagttgtggaatgcatcgcagttggagatggttcaccatggaaaaatgcatggattcatgaggtaatatatcatgaccagactcttacaaaatcacgcaattataaaatgtttattgaacagttttttttttatgaaactgcttgttatatttcttctgtacccatggcacattctagttagttgcccataacctattggcccacttgttgacaacatatggttattttacccatcatactgatggtgtggtgctaacctaaaggcattggattgcccccaccccatctttgctgacataactgattagtttgctttgttggatagatgggaattttctgacgttgtggtttactttatcctatgtcagaaaatatgaagttatttgaaaaaaagcattccttaaaaaattagttttctgtagagtttgtgtagttccaataaatttatgatgatctatgtgatatgtctggtagcaagcctttggtgcacataattctctttgattctgggcaaaccttttacactatttttgttcaacttttgttttggatctggaaagaaagaaaagtaagttgttttggcgaacatcaaagaatgatgttatatctaattgattcttagttctgaaggtaacagtgcctgtaaggactttttcctttcctaatgtagtagttgtctgtagaatgtactgggccaaaaagattctagaatggactagtggaccagaagaagcactttcaactgcaatttatttaaatgacaaggtaagacctatacacatgtttgggaaatacagttgtgttattttgaatttgtcctttttatagttttgctagttgtagttaaaatagctatatttcaacacatggaacatgataaagaaacatggaacatgataaagaaactgctcacatgaaaaattgtaattgaatagcaacttggaagagtctgcccatgcttaaattagttcctgcgccgataaccgaaaagttggagtcacatttatcaaattaagaaatatataatttgacattcttttcatgtaaggcagaaaattgtatggttggtgctcttttcattatcttatcttcccttaagttaaaaacatcatccttctagggacaaccagacaataaatcagcttcacggtcgcctcggataagctggactatcctttttcttggttacctgtcagaagaaagatacaaaacagtaactggggaaataaattttcaggaatgtgaaattgctcgaagatattttcatagttgaacctacaattctttccccagctggattgttctcgttctttaataggagtagttgtttgcattgaagtacttctacggattttatttatgcttttcaacaaagtcttacaaatcaatcttgtggcagtatgagatagatggcagggaccccagtggttacgtcggatgtatgtggtccatatgtggcctccatgatcaggtcattgtgttatcacttctcacttcacagggaaaaacaattttgcttttcacaagcattagattgttggtgacattctagaagcgagtattccttacaccactgctgttttctcagggttggaaggagcgtccagtatttggaaagatacgttacatgaattacgctggctgcaagagaaaattcgatgttgacgcttacatttcttatgtcaagagattagctggtcaatccaagaagaggaacgctgaggagtctccaaatcctgtagtcaagctttccaagtctcagcactaaatccgactaggaaaatatgaacatttctttgtgtggtataccacgagctcggaaaattgaagaacagtgctaacttgaggtagatcatgtagggtatacactgtagatctgtttgtctgatatccttgtaggcttctaatcattcaaaatttgctagcattgttaagactttaagacatacagtgtcacaccagttgaattcaagtgt</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189112.1 RefSeq:Os10g0167600]\|~~
−	}}
	[[Category:Genes]]		[[Category:Genes]]
	[[Category:Japonica mRNA]]		[[Category:Japonica mRNA]]

@@ Line 26: / Line 26: @@
 ===Evolution===
 Rice may have evolved a CPD photolyase that functions in chloroplasts, mitochondria and nuclei, and that contains DNA to protect cells from the harmful effects of UV-B radiation. The amino acid at position 126 of the deduced amino acid sequence of CPD photolyase in cultivars including such as Norin 1 was found to be arginine, the CPD photolyase activities of which were lower. The amino acid at that position in cultivars including such as Sasanishiki was glutamine, which has higher CPD photolyase activities.
 Rice cultivars vary widely in their sensitivity to ultraviolet B (UVB) and this has been correlated with cyclobutane pyrimidine dimer (CPD) photolyase mutations that alter the structure/function of this photorepair enzyme. Whether CPD photolyase function determines the UVB sensitivity of rice (Oryza sativa) by generating transgenic rice plants bearing the CPD photolyase gene of the UV-resistant rice cultivar Sasanishiki in the sense orientation (S-B and S-C lines) or the antisense orientation (AS-D line). The S-B and S-C plants had 5.1- and 45.7-fold higher CPD photolyase activities than the wild-type, respectively, were significantly more resistant to UVB-induced growth damage, and maintained significantly lower CPD levels in their leaves during growth under elevated UVB radiation. Conversely, the AS-D plant had little photolyase activity, was severely damaged by elevated UVB radiation, and maintained higher CPD levels in its leaves during growth under UVB radiation. Notably, the S-C plant was not more resistant to UVB-induced growth inhibition than the S-B plant, even though it had much higher CPD photolyase activity. These results strongly indicate that UVB-induced CPDs are one of principal causes of UVB-induced growth inhibition in rice plants grown under supplementary UVB radiation, and that increasing CPD photolyase activity can significantly alleviate UVB-caused growth inhibition in rice. However, further protection from UVB-induced damage may require the genetic enhancement of other systems as well.

@@ Line 16: / Line 16: @@
 ===Expression===
 Full-length CPD photolyase is encoded by a single gene, not a splice variant, and is expressed and targeted not only to nuclei but also to chloroplasts and mitochondria. Over-expressing CPD photolyase enhances thein vitro photorepair ability of rice. CPD photolyase-over-expressing plants are significantly more resistant to the growth-impairing effects of UVB radiation than the WT plant.
 [[File:Organization of theOryza sativacyclobutane pyrimidine dimer photolyase gene and alignments of the nucleotide sequence and corresponding amino.jpg]]
 Fig.Organization of theOryza sativacyclobutane pyrimidine dimer photolyase gene and alignments of the nucleotide sequence and corresponding amino

@@ Line 16: / Line 16: @@
 ===Expression===
 Full-length CPD photolyase is encoded by a single gene, not a splice variant, and is expressed and targeted not only to nuclei but also to chloroplasts and mitochondria. Over-expressing CPD photolyase enhances thein vitro photorepair ability of rice. CPD photolyase-over-expressing plants are significantly more resistant to the growth-impairing effects of UVB radiation than the WT plant.
 The rice may have evolved a CPD photolyase that functions in chloroplasts, mitochondria and nuclei, and that contains DNA to protect cells from the harmful effects of UV-B radiation.

← Older revision		Revision as of 15:58, 9 June 2014
Line 10:		Line 10:

	[[File:Analysis of the rice cyclobutane pyrimidine dimer (CPD) photolyase gene copy number.jpg]]		[[File:Analysis of the rice cyclobutane pyrimidine dimer (CPD) photolyase gene copy number.jpg]]
		+	[[File:Repair of UV-B-induced DNA damage in rice genomic DNA in the.jpg]]

	Plants use sunlight as energy for photosynthesis; however, plant DNA is exposed to the harmful effects of ultraviolet-B (UV-B) radiation (280–320 nm) in the process. UV-B radiation damages nuclear, chloroplast and mitochondrial DNA by the formation of cyclobutane pyrimidine dimers (CPDs), which are the primary UV-B-induced DNA lesions, and are a principal cause of UV-B-induced growth inhibition in plants. Repair of CPDs is therefore essential for plant survival while exposed to UV-B-containing sunlight. Nuclear repair of the UV-B-induced CPDs involves the photoreversal of CPDs, photoreactivation, which is mediated by CPD photolyase that monomerizes the CPDs in DNA by using the energy of near-UV and visible light (300–500 nm).		Plants use sunlight as energy for photosynthesis; however, plant DNA is exposed to the harmful effects of ultraviolet-B (UV-B) radiation (280–320 nm) in the process. UV-B radiation damages nuclear, chloroplast and mitochondrial DNA by the formation of cyclobutane pyrimidine dimers (CPDs), which are the primary UV-B-induced DNA lesions, and are a principal cause of UV-B-induced growth inhibition in plants. Repair of CPDs is therefore essential for plant survival while exposed to UV-B-containing sunlight. Nuclear repair of the UV-B-induced CPDs involves the photoreversal of CPDs, photoreactivation, which is mediated by CPD photolyase that monomerizes the CPDs in DNA by using the energy of near-UV and visible light (300–500 nm).

@@ Line 4: / Line 4: @@
 Protein： Cyclobutane pyrimidine dimer (CPD) photolyase
-[[File:Example.jpg]]===Function===
+[[File:Example.jpg]]
 Repair of CPDs is essential for plant survival while exposed to UV-B-containing sunlight. Nuclear repair of the UV-B-induced CPDs involves the photoreversal of CPDs, photoreactivation, which is mediated by CPD photolyase that monomerizes the CPDs in DNA by using the energy of near-UV and visible light (300–500 nm).There are two kinds of CPD pthotolyase existed in rice leaves. One is 54kD and another is 56kD protein. The 56-kD native rice CPD photolyase was phosphorylated, which has significantly higher CPD photorepair activity. The native rice CPD photolyase possesses both a pterin-like chromophore and an FAD chromophore. Single amino acid alteration from glutamine to arginine leads to a deficit of CPD photolyase activity and that CPD photolyase activity is one of the main factors determining UVB sensitivity in rice.
-[[Analysis of the rice cyclobutane pyrimidine dimer (CPD) photolyase gene copy number.jpg]]
+[[File:Analysis of the rice cyclobutane pyrimidine dimer (CPD) photolyase gene copy number.jpg]]
 Plants use sunlight as energy for photosynthesis; however, plant DNA is exposed to the harmful effects of ultraviolet-B (UV-B) radiation (280–320 nm) in the process. UV-B radiation damages nuclear, chloroplast and mitochondrial DNA by the formation of cyclobutane pyrimidine dimers (CPDs), which are the primary UV-B-induced DNA lesions, and are a principal cause of UV-B-induced growth inhibition in plants. Repair of CPDs is therefore essential for plant survival while exposed to UV-B-containing sunlight. Nuclear repair of the UV-B-induced CPDs involves the photoreversal of CPDs, photoreactivation, which is mediated by CPD photolyase that monomerizes the CPDs in DNA by using the energy of near-UV and visible light (300–500 nm).