Os10g0563600 - Revision history

Xysj1990: /* Function */

2016-07-01T08:59:58Z

‎Function

Rice2012: /* References */

2015-06-13T08:57:56Z

‎References

Lmw2015: /* Structured Information */

2015-06-12T04:16:15Z

‎Structured Information

Zhangye at 15:34, 28 January 2015

2015-01-28T15:34:36Z

Zhangye at 15:00, 3 January 2015

2015-01-03T15:00:17Z

Zhangye at 14:48, 3 January 2015

2015-01-03T14:48:23Z

Zhangye at 14:45, 3 January 2015

2015-01-03T14:45:02Z

124.16.129.48 at 21:13, 22 July 2012

2012-07-22T21:13:04Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os10g0563600| Description = Similar to Peptide methionine sulfoxide reductase (EC 1.8.4.6) (Protein- methionine-S-oxide reductase) (Peptide Met(O)..."

2012-06-21T08:48:47Z

Created page with "{{JaponicaGene| GeneName = Os10g0563600| Description = Similar to Peptide methionine sulfoxide reductase (EC 1.8.4.6) (Protein- methionine-S-oxide reductase) (Peptide Met(O)..."

New page

{{JaponicaGene|
GeneName = Os10g0563600|
Description = Similar to Peptide methionine sulfoxide reductase (EC 1.8.4.6) (Protein- methionine-S-oxide reductase) (Peptide Met(O) reductase)|
Version = NM_001071935.1 GI:115483465 GeneID:4349402|
Length = 2293 bp|
Definition = Oryza sativa Japonica Group Os10g0563600, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
AP = Chromosome 10:22710059..22712351|
CDS = 22710164..22710703,22711880..22712131|
GCID = <gbrowseImage1>
name=NC_008403:22710059..22712351
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008403:22710059..22712351
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcctcctctcctcgcctccacctcctccacgtcccctctcctcctcgcctctcgcctccgcggaggcggcggctgcggctgcggcggcgcccctctcctccaccggacgcgccgcggcttcctcgcgccgagcaccaccaccacccagacgacgaggacgagtttcgcggcgatgagctggctcgggaagctggggctgggcgggctggggggaagcccgcgggcgtcggcggcgtcggcggcgctggcgcagggccccgatgaggaccgcccggcggccgggaacgagttcgcgcagttcggcgccgggtgcttctggggcgtggagctcgcgttccagcgcgtccccggcgtgactcgcaccgaggtgggatacagccaggggaacctccacgacccgacctacgaggacgtctgcaccggcgccacctaccacaacgaggtcgtccgcgtccactacgacgtctccgcctgcaagttcgacgacctcctcgacgtcttctgggcgcgccacgatcccaccacgcccaaccgccagggtaatgatgttgggacccaatacaggtcaggtatctactactacacccctgagcaggagaaggcggcaagagaatctctggagaagcagcagaagcttctgaatcggacgattgtcactgaaattcttcctgcaaagaggttctacagggcagaggagtaccaccagcaataccttgcgaaaggcggtcgcttcgggttcaggcagtctgcggagaagggttgcaacgaccccatccgttgctacgggtga</cdnaseq>|
AA = <aaseq>MPPLLASTSSTSPLLLASRLRGGGGCGCGGAPLLHRTRRGFLAP STTTTQTTRTSFAAMSWLGKLGLGGLGGSPRASAASAALAQGPDEDRPAAGNEFAQFG AGCFWGVELAFQRVPGVTRTEVGYSQGNLHDPTYEDVCTGATYHNEVVRVHYDVSACK FDDLLDVFWARHDPTTPNRQGNDVGTQYRSGIYYYTPEQEKAARESLEKQQKLLNRTI VTEILPAKRFYRAEEYHQQYLAKGGRFGFRQSAEKGCNDPIRCYG</aaseq>|
DNA = <dnaseqindica>106..645#1822..2073#aagcgaagcaaccacaccaggcaccaaggcaccaaccaaccgcgcgtcgaagcttctgggccacgccgccacaaaagccgaagcggaaaggaaaagcctccctcgatgcctcctctcctcgcctccacctcctccacgtcccctctcctcctcgcctctcgcctccgcggaggcggcggctgcggctgcggcggcgcccctctcctccaccggacgcgccgcggcttcctcgcgccgagcaccaccaccacccagacgacgaggacgagtttcgcggcgatgagctggctcgggaagctggggctgggcgggctggggggaagcccgcgggcgtcggcggcgtcggcggcgctggcgcagggccccgatgaggaccgcccggcggccgggaacgagttcgcgcagttcggcgccgggtgcttctggggcgtggagctcgcgttccagcgcgtccccggcgtgactcgcaccgaggtgggatacagccaggggaacctccacgacccgacctacgaggacgtctgcaccggcgccacctaccacaacgaggtcgtccgcgtccactacgacgtctccgcctgcaagttcgacgacctcctcgacgtcttctgggcgcgccacgatcccaccacgcccaaccgccaggtcagccagccacagattaactcgattcacaaacctaatcgcatgatttcgtttaccgtaccttgctctatgcttaatttcgggttctttgattgagtgggtggcagggaggttcagaattggggatttcatttacgataatttcgtgagggtttagtggaattgaagaattaggctactgatattactagttcagttagtaggagtcactagacagatattctactgcaaatttttacagagaagaagaattcctcgcgagtaaggtaaatcactctatatacgaaagaaacgtgggtgctgtcgtgcacagtaagagctcaaacctgtgacaagtgcggcatagaattgactatcagtactgcggtttcttaattagcttgcaggtcacggctgaccggaattattgatgagttcctcaccaaccaaaggagcttactttggccttatgttctttacgcagttttggtttacagcaagtaccacaatcccataatcctgagcactggcagagaatagactgtcatagcgtcatggttgtgttaggctgtgggcactcagcgttgattgtcctgttcatgggaccattgggcccaatgaatcaggttctgttatattggatcaagaatttgcagcatcccagctgcagtttgcactttcatcatcaaagggccgaataccaagtggctacctgcatattaatcttgagcagtcaatgttatagtgtgggtactgttagcaagtatataccatcatattggtgttatcggttggtttgacaagcatctaattttgtagtggtgctgagtctagcatgtcttgcagtgtttgtaatgcataaccttgcacttgggcagcgctatgtaattttgcaagatcgattgcctatagtatgtatcattttgtgttcactaatttatgtataacttgcatcttgattctttagattggtggacaattgactgctaccaaggagtgccaccaaaaataacaaactaactgaaaaaaaataacttagcctgttattttgttctgttttctgaacaaaccaatgctgatttgcattagataaacttgttcctagacaattagattctatttctttcaagcatccgtttgactgtttgacataactgaagtttctgatcacatatactctgaactctttgtatgcagggtaatgatgttgggacccaatacaggtcaggtatctactactacacccctgagcaggagaaggcggcaagagaatctctggagaagcagcagaagcttctgaatcggacgattgtcactgaaattcttcctgcaaagaggttctacagggcagaggagtaccaccagcaataccttgcgaaaggcggtcgcttcgggttcaggcagtctgcggagaagggttgcaacgaccccatccgttgctacgggtgaagggcaagtttgaaccagaacgccacacaagaacagtgcttgaataaggataaataatagccagacaaaaattatgcagcataatactattttgttacctttgtttgtatcaatccatcgattgtaagagatgagctgaacctggaccatgatacttgccgctgattatgtacaaaccaccttagaaaacttgatatagtattatccttttcgatgcggg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071935.1 RefSeq:Os10g0563600]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

@@ Line 4: / Line 4: @@
 ===Function===
 *''OsMSRA4.1'' and ''OsMSRB1.1'' are constitutively expressed in all organs and can be induced by various stress conditions. Overexpression of either ''OsMSRA4.1'' or ''OsMSRB1.1'' in yeast enhanced cellular resistance to oxidative stress. In addition, OsMSRA4.1-overexpressing transgenic rice plants also showed enhanced viability under salt treatment.''OsMSRA4.1'' plays an important role in stress responses<ref name="ref1"/>.
-*Cloning of ''OsMSRA4.1'' cDNAs:
+*Cloning of ''OsMSRA4.1'' cDNAs:<br>Total RNA from rice leaves was extracted using the guanidinium isocyanate/acidic phenol method as described by ''Chomczynski and Sacchi''. cDNA synthesis and RTPCR were performed using a kit. The ''OsMSRA4.1'' gene-specific primers were 5'-TCGATGCCTCCTCTCCTCG-3'� and 5'-AGGATCCTTCACCCGTAGCAACGGAT-3' The ''OsMSRA4.1'' cDNAs was cloned into the yeast expression vector p181AINE and the constructs were transformed into yeast using the lithium acetate method<ref name="ref1"/>.
 '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0008113 GO:0008113], [http://amigo.geneontology.org/amigo/term/GO:0019538 GO:0019538]

← Older revision		Revision as of 08:57, 13 June 2015
Line 73:		Line 73:
	[[Category:Japonica Chromosome 10]]		[[Category:Japonica Chromosome 10]]
	[[Category:Chromosome 10]]		[[Category:Chromosome 10]]
		+	==Structured Information==

← Older revision		Revision as of 15:34, 28 January 2015
Line 1:		Line 1:
−	''OsMSRA4.1'' is a ~~mumber~~ of MSRA, which belongs to methionine sulfoxide reductases (MSRs)<ref name="ref1"/><ref name="ref2"/>.	+	''OsMSRA4.1'' is a member of MSRA, which belongs to methionine sulfoxide reductases (MSRs)<ref name="ref1"/><ref name="ref2"/>.

	==Annotated Information==		==Annotated Information==

@@ Line 42: / Line 42: @@
 ===Knowledge Extension===
-In rice genome, MSR is encoded by a multigene family with at least seven members. The relatively large number of MSR genes in plants is particularly signiWcant. In ''Arabidopsis'', the number of genes encoding for MSRs is even larger with 14 members, when compared to 9 in poplar and 7 in rice<ref name="ref5"/>. whereas generally mammals, yeast, and E. coli possess 2–4 MSR genes.
+In rice genome, MSR is encoded by a multigene family with at least seven members. The relatively large number of MSR genes in plants is particularly signiWcant. In ''Arabidopsis'', the number of genes encoding for MSRs is even larger with 14 members, when compared to 9 in poplar and 7 in rice<ref name="ref5"/> whereas generally mammals, yeast, and E. coli possess 2–4 MSR genes.
 ==Labs working on this gene==

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-*''OsMSRA4.1'' and ''OsMSRB1.1'' are constitutively expressed in all organs and can be induced by various stress conditions. Overexpression of either ''OsMSRA4.1'' or ''OsMSRB1.1'' in yeast enhanced cellular resistance to oxidative stress. In addition, OsMSRA4.1-overexpressing transgenic rice plants also showed enhanced viability under salt treatment.''OsMSRA4.1'' plays an important role in stress responses.
+*''OsMSRA4.1'' and ''OsMSRB1.1'' are constitutively expressed in all organs and can be induced by various stress conditions. Overexpression of either ''OsMSRA4.1'' or ''OsMSRB1.1'' in yeast enhanced cellular resistance to oxidative stress. In addition, OsMSRA4.1-overexpressing transgenic rice plants also showed enhanced viability under salt treatment.''OsMSRA4.1'' plays an important role in stress responses<ref name="ref1"/>.
 *Cloning of ''OsMSRA4.1'' cDNAs:
 Total RNA from rice leaves was extracted using the guanidinium isocyanate/acidic phenol method as described by ''Chomczynski and Sacchi''. cDNA synthesis and RTPCR were performed using a kit. The ''OsMSRA4.1'' gene-specific primers were 5'-TCGATGCCTCCTCTCCTCG-3'� and 5'-AGGATCCTTCACCCGTAGCAACGGAT-3' The ''OsMSRA4.1'' cDNAs was cloned into the yeast expression vector p181AINE and the constructs were transformed into yeast using the lithium acetate method<ref name="ref1"/>.
@@ Line 11: / Line 11: @@
 ===Mutation===
 [[File:OsMSRA4.1 transgenic.jpg|left|thumb|300px|'''Figure 1.'''''Growth of OsMSRA4.1-overexpressing rice plants upon salt treatment.(from reference <ref name="ref1"/>).'']]
-To test whether OsMSRs are involved in stress responses, transgenic rice plants harboring OsMSRA4.1 were generated. Positive transgenic lines (line 9 and line 43) were confirmed by Northern and Western analyses and selected for further analysis (Fig. 1a).
+To test whether OsMSRs are involved in stress responses, transgenic rice plants harboring OsMSRA4.1 were generated. Positive transgenic lines (line 9 and line 43) were confirmed by Northern and Western analyses and selected for further analysis<ref name="ref1"/>(Fig. 1a).
 ===Expression===
@@ Line 25: / Line 25: @@
 control rice plants wilted during extended treatment and showed salt-induced leaf curling, while OsMSRA4.1 transgenic plants grew much better than the control plants(Fig. 1c). the photosynthetic rate of OsMSRA4.1-overexpressing lines was 17–27% higher
 than that of wild-type plants under salt stress condition(Fig. 1d), which suggesting that overexpression of ''OsMSRA4.1'' reduced the severity of the stress-induced impact on the photosynthesis.As shown in Fig. 1e and f, the relative electrolyte leakage
-values of OsMSRA4.1 transgenic lines were much lower(17–32%) than that of wild-type plants under salt treatment for 2 days, and MDA content in ''OsMSRA4.1'' transgenic lines is also lower than wild-type, indicating that transgenic lines were more tolerant to salt stress than wild-type. Under normal conditions, there is no obvious diVerence on relative conductance and MDA between transgenic plants and wild-type.
+values of OsMSRA4.1 transgenic lines were much lower(17–32%) than that of wild-type plants under salt treatment for 2 days, and MDA content in ''OsMSRA4.1'' transgenic lines is also lower than wild-type, indicating that transgenic lines were more tolerant to salt stress than wild-type. Under normal conditions, there is no obvious diVerence on relative conductance and MDA between transgenic plants and wild-type<ref name="ref1"/>.
 ===Subcellular localization===

@@ Line 67: / Line 67: @@
 </references>
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+''OsMSRA4.1'' is a mumber of MSRA, which belongs to methionine sulfoxide reductases (MSRs)<ref name="ref1"/><ref name="ref2"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+*''OsMSRA4.1'' and ''OsMSRB1.1'' are constitutively expressed in all organs and can be induced by various stress conditions. Overexpression of either ''OsMSRA4.1'' or ''OsMSRB1.1'' in yeast enhanced cellular resistance to oxidative stress. In addition, OsMSRA4.1-overexpressing transgenic rice plants also showed enhanced viability under salt treatment.''OsMSRA4.1'' plays an important role in stress responses.
 ===Expression===
-Please input expression information here.
+*Overexpression of ''OsMSRA4.1'' enhances yeast tolerance to H<sub>2</sub>O<sub>2</sub> stress, and that the ''OsMSRA4'' can compensate for a deficiency in MSRA.
 ===Evolution===
-Please input evolution information here.
+[[File: MSR Phylogenetic tree.jpg|left|thumb|300px|'''Table 1.'''''Phylogenetic tree of MSRAs and MSRBs from Arabidopsis thaliana, Populus trichocarpa and Oryza sativa.(from reference <ref name="ref2"/>).'']]
-You can also add sub-section(s) at will.
+===Knowledge Extension===
 ==Labs working on this gene==
-Please input related labs here.
+*State Key Laboratory of Plant Genomics, National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences (CAS), 100101 Beijing, China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 21:13, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os10g0563600\|		GeneName = Os10g0563600\|