Os11g0454000 - Revision history

Xysj2027 at 15:57, 6 May 2017

2017-05-06T15:57:16Z

Xysj2027 at 15:56, 6 May 2017

2017-05-06T15:56:53Z

Xysj2027: /* References */

2017-05-06T15:52:53Z

‎References

Xysj2027 at 15:52, 6 May 2017

2017-05-06T15:52:25Z

Xysj2027 at 15:51, 6 May 2017

2017-05-06T15:51:29Z

Xysj2012 at 02:13, 30 June 2016

2016-06-30T02:13:48Z

Rice2012: /* References */

2015-06-13T09:07:41Z

‎References

Lmw2015: /* Structured Information */

2015-06-12T04:25:45Z

‎Structured Information

Sunny1227 at 00:21, 11 June 2014

2014-06-11T00:21:46Z

Sunny1227 at 00:20, 11 June 2014

2014-06-11T00:20:10Z

@@ Line 1: / Line 1: @@
-The rice '''''Os11g0454000''''' was reported as '''''rab16C''''' in 1990 <ref name="ref1" /> by researchers from Japan.
+The rice '''''Os11g0454000''''' was reported as '''''rab16C''''' in 1990 by researchers from Japan.
 ==Annotated Information==
 ===Gene Symbol===

@@ Line 1: / Line 1: @@
+The rice '''''Os11g0454000''''' was reported as '''''rab16C''''' in 1990 <ref name="ref1" /> by researchers from Japan.
 ==Annotated Information==
 ===Gene Symbol===

@@ Line 28: / Line 28: @@
 ==References==
-[1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
+* [1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
-[2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
+* [2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
-[3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
+* [3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
-[4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
+* [4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
-[5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.
+* [5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.
@@ Line 45: / Line 45: @@
 [[Category:Japonica Chromosome 11]]
 [[Category:Chromosome 11]]
 == Structured Information ==

@@ Line 1: / Line 1: @@
-The description of the rice '''Os11g0454000'''gene is the  '''''rab16c''''' gene. The  '''''rab16c''''' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.
 ==Annotated Information==
 ===Gene Symbol===
@@ Line 5: / Line 5: @@
 ===Function===
 * The  ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
 * The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well as stomatal function and the response of plant tissues to osmotic stress.

@@ Line 1: / Line 1: @@
 The description of the rice '''Os11g0454000'''gene is the  '''''rab16c''''' gene. The  '''''rab16c''''' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.
 ==Annotated Information==
 ===Function===
-Drought and salt are two adverse factors affecting seriously growth, development, and productivity of rice. when subjecting rice to drought and salt as stresses, plants increase ABA sensitivity in rice . The  ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
+* The  ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
-The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well
+* The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well as stomatal function and the response of plant tissues to osmotic stress.
 as stomatal function and the response of plant tissues to osmotic stress.
 ===Expression===
-Its expression is not tissue specific high in ABA-treated seedlings and roots and  responsive to osmotic stress. Its mRNA accumulates to detectable levels in mature embryos.
+* Its expression is not tissue specific high in ABA-treated seedlings and roots and  responsive to osmotic stress.
 ===Evolution===
-Two types of conserved DNA sequence motifs are found in the promoter regions of the ''rab 16C'' genes . The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes. The
+* Two types of conserved DNA sequence motifs are found in the promoter regions of the ''rab 16C'' genes.
-core of Motif II (CGG/CCGCGCT), found once in ''rab 16C'', is 80% homologous with the binding site of SP1, an auxilliary transcription factor . These elements may play a role in modulating the transcriptional activation in the rab genes.Another conserved sequence, whose core is found in the promoter regions of ABA-responsive cotton genes, is reminiscent of the cAMP responsive element.
+* The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes.
-Ose717 shared a 91% homology with the 140 nucleotide coding sequences of a rice ABA response gene, ''rab16C''. The high degree of homology within the coding region implied that the genes were closely related.
+* The core of Motif II (CGG/CCGCGCT), found once in ''rab 16C'', is 80% homologous with the binding site of SP1, an auxilliary transcription factor.
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* Laboratory  of Plant Molecular  Biology,  Rockefeller   University,  1230 York Avenue, New York, NY 10021, USA
 ==References==
 [1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
 [2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
 [3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
 [4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
 [5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.

← Older revision		Revision as of 09:07, 13 June 2015
Line 32:		Line 32:
	[[Category:Japonica Chromosome 11]]		[[Category:Japonica Chromosome 11]]
	[[Category:Chromosome 11]]		[[Category:Chromosome 11]]
		+	== Structured Information ==

← Older revision		Revision as of 04:25, 12 June 2015
Line 26:		Line 26:


−	~~==Structured Information==~~
−	~~{{JaponicaGene\|~~
−	~~GeneName = Os11g0454000\|~~
−	~~Description = Dehydrin RAB 16C\|~~
−	~~Version = NM_001074374.1 GI:115485396 GeneID:4350452\|~~
−	~~Length = 889 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os11g0454000, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 11\|Chromosome 11]]\|~~
−	~~AP = Chromosome 11:17154225..17155113\|~~
−	~~CDS = 17154447..17154713,17154809..17155036\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008404:17154225..17155113~~
−	~~source=RiceChromosome11~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008404:17154225..17155113~~
−	~~source=RiceChromosome11~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcgtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaa</cdnaseq>\|
−	AA = <aaseq>MENYQGQHGYGADRVDVYGNPVAGQYGGGATAPGGGHGVMGMGG HHAGAGGQFQPVKEEHKTGGILHRSGSSSSSSSSEDDGMGGRRKKGIKEKIKEKLPGG NKGNNQQQQQMMGNTGGAYGQQGHAGMTGAGTGTGVHGAEYGNTGEKKGFMDKIKEKL PGQH</aaseq>\|
−	DNA = <dnaseqindica>401..667#78..305#atcgatcacaagacacaagatttttcactgatagaatagcaacacttgggtgagagatcagacgcgtgtttgagaagatggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcggtacgttcactgtcgtccattcataaatctaattaatcgcctcgcttctgaattcctttatttaatttgagttgtactcgtgtgcgtttgtgcagtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaaataagctcgaccgggtcgtcaccaaatatgtcgtgatgtacgtgcagttttatatgttgttgaataaactagcgtgaaatgcgagtgatggtgtcttctgccttgggacggatgacacattgtctgttgtgttctcgcgtccgtgtcggttttacccttgaaatgtaatatggtgtgtgtacacactaaggttttattgaagtgtgactttgtgcttgtgtt</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074374.1 RefSeq:Os11g0454000]\|~~
−	}}
	[[Category:Genes]]		[[Category:Genes]]
	[[Category:Japonica mRNA]]		[[Category:Japonica mRNA]]

← Older revision		Revision as of 00:21, 11 June 2014
Line 1:		Line 1:
−	~~Please input one-sentence summary here.~~
	The description of the rice '''Os11g0454000'''gene is the ''rab 16c'' gene. The ''rab 16c'' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.		The description of the rice '''Os11g0454000'''gene is the ''rab 16c'' gene. The ''rab 16c'' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.
	==Annotated Information==		==Annotated Information==