Os11g0592200 - Revision history

Xysj2017: /* Expression */

2017-02-15T01:56:27Z

‎Expression

Xysj2017 at 01:55, 15 February 2017

2017-02-15T01:55:57Z

Xysj2017 at 01:35, 15 February 2017

2017-02-15T01:35:10Z

Xysj2017 at 01:20, 15 February 2017

2017-02-15T01:20:41Z

Xysj2017 at 01:09, 15 February 2017

2017-02-15T01:09:47Z

192.168.72.52 at 13:58, 14 May 2015

2015-05-14T13:58:03Z

124.16.129.48 at 21:22, 22 July 2012

2012-07-22T21:22:04Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os11g0592200| Description = Similar to Chitin-binding allergen Bra r 2 (Fragments)| Version = NM_001074722.1 GI:115486092 GeneID:4350823| Length..."

2012-06-21T09:15:19Z

Created page with "{{JaponicaGene| GeneName = Os11g0592200| Description = Similar to Chitin-binding allergen Bra r 2 (Fragments)| Version = NM_001074722.1 GI:115486092 GeneID:4350823| Length..."

New page

{{JaponicaGene|
GeneName = Os11g0592200|
Description = Similar to Chitin-binding allergen Bra r 2 (Fragments)|
Version = NM_001074722.1 GI:115486092 GeneID:4350823|
Length = 869 bp|
Definition = Oryza sativa Japonica Group Os11g0592200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
AP = Chromosome 11:24354046..24354914|
CDS = 24354266..24354538,24354624..24354791|
GCID = <gbrowseImage1>
name=NC_008404:24354046..24354914
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008404:24354046..24354914
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcggggatcaccggatctcgagcactcatggtggtggcgctcctctgcgctgccgcggccatgactgctgcacaagaagcatccaacgtgcgagccacgtatcattattacaacccacaacagaacaactgggacctgaacaaagtgagcgcatattgtgccacatgggatgccaacaaaccgttgtcttggcgccagaagtatggatggaccgccttctgtggacctgctggtcctaggggccgagactcgtgtggcaagtgtatccaggtgaagaaccggggaacaggtgcgacaataattgcgaggattgttgaccaatgcagcaatggtgggttggatctggactacgagaccatcttcaagaagatcgacacagatggtcgtggctaccagatgggtcacctccaggtcgattacaagttcgtcaattgttga</cdnaseq>|
AA = <aaseq>MAGITGSRALMVVALLCAAAAMTAAQEASNVRATYHYYNPQQNN WDLNKVSAYCATWDANKPLSWRQKYGWTAFCGPAGPRGRDSCGKCIQVKNRGTGATII ARIVDQCSNGGLDLDYETIFKKIDTDGRGYQMGHLQVDYKFVNC</aaseq>|
DNA = <dnaseqindica>221..493#579..746#cccatctgcaacagagaaagattgtgccacagtacaaactacctcattctccatcaggtgcacaatagaagaaactaaggtaagcactacattggcacccattcacccaagatccctatttctctcttccaaatcttcctctagcatgaagataagattgtacttatgataacgaattatctttttatttatacacatgaatatttagattctcaaagtgatggcggggatcaccggatctcgagcactcatggtggtggcgctcctctgcgctgccgcggccatgactgctgcacaagaagcatccaacgtgcgagccacgtatcattattacaacccacaacagaacaactgggacctgaacaaagtgagcgcatattgtgccacatgggatgccaacaaaccgttgtcttggcgccagaagtatggatggaccgccttctgtggacctgctggtcctaggggccgagactcgtgtggcaagtgtatccaggtattaaaattttcttcacattgacaaccgatttgtacttcaacattaaactgagtcgcttaaggatggtgtgctaaatttgtaggtgaagaaccggggaacaggtgcgacaataattgcgaggattgttgaccaatgcagcaatggtgggttggatctggactacgagaccatcttcaagaagatcgacacagatggtcgtggctaccagatgggtcacctccaggtcgattacaagttcgtcaattgttgatttggtcatgcctctttgcatgatcatatactggaataagaaatatatggtgttatacaataagatggaagaggttggcactctgtaatcatgctgaataatgaataaacgaaattacagttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074722.1 RefSeq:Os11g0592200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 11]]
[[Category:Chromosome 11]]

@@ Line 15: / Line 15: @@
 * Their expression levels were strongly induced by at least one of the stress treatments including drought, salt, cold, wounding, heat shock, and ultraviolet.
 * The transcript levels of OsPR4 genes were also induced by some phytohormones such as abscisic acid and jasmonic acid.
+<br>
 [[File:232-Os11g0592200.png|center|thumb|727px|'''Figure 4. (SnapShot)''' ''Expression level of OsPR4 genes in various tissues or organs. (A) Expression levels examined by quantitative real-time RT-PCR.<ref name="ref1" />.'']]

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Gene Symbol===
-*'''''Os11g0592200''''' '''<=>''' '''''OsPR4,OsPR4a,PR4a,OsPR-4'''''
+* '''''Os11g0592200''''' '''<=>''' '''''OsPR4,OsPR4a,PR4a,OsPR-4'''''
 ===Function===
-* Metallothioneins (MTs) are small, cysteine-rich, metal-binding proteins that may be involved in metal homeostasis and detoxification in both plants and animals.
+* '''''PR4''''' proteins constitute a pathogenesis-related (PR) protein family with a conserved BARWIN domain.
-* OsMT1a, encodes a type 1 metallothionein.
+* The rice PR4 genes are also involved in abiotic stress responses and tolerance in addition to their responsiveness to pathogen attacks.
 ===Phenotypic analysis===
-* Both transgenic plants and yeasts harboring OsMT1a accumulated more Zn(2+) than wild type controls, suggesting '''''OsMT1a''''' '''is most likely to be involved in zinc homeostasis'''.
+* Transgenic rice with overexpression of '''''OsPR4a''''' showed enhanced tolerance to drought at both seedling and reproductive stages..
 ===Expression===
-* Expression analysis revealed that OsMT1a predominantly expressed in the roots, and was induced by dehydration.
+* OsPR4 genes showed diverse temporal–spatial expression patterns, and their expressions are responsive to Magnaporthe grisea infection. Interestingly, the OsPR4 genes are also responsive to abiotic stresses.
-* The OsMT1a expression was also induced specifically by Zn treatment.
+* Their expression levels were strongly induced by at least one of the stress treatments including drought, salt, cold, wounding, heat shock, and ultraviolet.
 You can also add sub-section(s) at will.

@@ Line 1: / Line 1: @@
-The rice '''''Os11g0592200''''' was reported as '''''OsPR4''''' in 2009 <ref name="ref1" /> by researchers from China.
+The rice '''''Os11g0592200''''' was reported as '''''OsPR4a''''' in 2009 <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
@@ Line 26: / Line 26: @@
 ==Labs working on this gene==
-* State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, 100101 Beijing, China
+* National Key Laboratory of Crop Genetic Improvement and National Center of Plant Gene Research, Huazhong Agricultural University, Wuhan 430070, China
 ==References==
 <references>
 * <ref name="ref1">
-Yang Z, Wu Y, Li Y, Ling HQ, Chu C. OsMT1a, a type 1 metallothionein, plays
+Wang N, Xiao B, Xiong L. Identification of a cluster of PR4-like genes
-the pivotal role in zinc homeostasis and drought tolerance in rice. Plant Mol
+involved in stress responses in rice. J Plant Physiol. 2011 Dec
-Biol. 2009 May;70(1-2):219-29. doi: 10.1007/s11103-009-9466-1. PubMed PMID:
+;168(18):2212-24. doi: 10.1016/j.jplph.2011.07.013. PubMed PMID: 21955397.
 </ref>
 </references>
 ==Structured Information==
 		 [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]

@@ Line 1: / Line 1: @@
-The rice '''''Os11g0592200''''' was reported as '''''OsMT1a''''' in 2009 <ref name="ref1" /> by researchers from China.
+The rice '''''Os11g0592200''''' was reported as '''''OsPR4''''' in 2009 <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
 ===Function===
 * Metallothioneins (MTs) are small, cysteine-rich, metal-binding proteins that may be involved in metal homeostasis and detoxification in both plants and animals.

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os11g0592200''''' was reported as '''''OsMT1a''''' in 2009 <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+* Metallothioneins (MTs) are small, cysteine-rich, metal-binding proteins that may be involved in metal homeostasis and detoxification in both plants and animals.
 ===Expression===
-Please input expression information here.
+* Expression analysis revealed that OsMT1a predominantly expressed in the roots, and was induced by dehydration.
+* The OsMT1a expression was also induced specifically by Zn treatment.
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* State Key Laboratory of Plant Genomics and National Center for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, The Chinese Academy of Sciences, 100101 Beijing, China
 ==References==
-Please input cited references here.
+<references>
+* <ref name="ref1">
 ==Structured Information==
 		 [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]

← Older revision		Revision as of 13:58, 14 May 2015
Line 20:		Line 20:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 11]]
−	~~GeneName = Os11g0592200\|~~
−	~~Description = Similar to Chitin-binding allergen Bra r 2 (Fragments)\|~~
−	~~Version = NM_001074722.1 GI:115486092 GeneID:4350823\|~~
−	~~Length = 869 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os11g0592200, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 11\|Chromosome 11]]\|~~
−	~~AP = Chromosome 11:24354046..24354914\|~~
−	~~CDS = 24354266..24354538,24354624..24354791\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008404:24354046..24354914~~
−	~~source=RiceChromosome11~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008404:24354046..24354914~~
−	~~source=RiceChromosome11~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggcggggatcaccggatctcgagcactcatggtggtggcgctcctctgcgctgccgcggccatgactgctgcacaagaagcatccaacgtgcgagccacgtatcattattacaacccacaacagaacaactgggacctgaacaaagtgagcgcatattgtgccacatgggatgccaacaaaccgttgtcttggcgccagaagtatggatggaccgccttctgtggacctgctggtcctaggggccgagactcgtgtggcaagtgtatccaggtgaagaaccggggaacaggtgcgacaataattgcgaggattgttgaccaatgcagcaatggtgggttggatctggactacgagaccatcttcaagaagatcgacacagatggtcgtggctaccagatgggtcacctccaggtcgattacaagttcgtcaattgttga</cdnaseq>\|
−	AA = <aaseq>MAGITGSRALMVVALLCAAAAMTAAQEASNVRATYHYYNPQQNN WDLNKVSAYCATWDANKPLSWRQKYGWTAFCGPAGPRGRDSCGKCIQVKNRGTGATII ARIVDQCSNGGLDLDYETIFKKIDTDGRGYQMGHLQVDYKFVNC</aaseq>\|
−	DNA = <dnaseqindica>221..493#579..746#cccatctgcaacagagaaagattgtgccacagtacaaactacctcattctccatcaggtgcacaatagaagaaactaaggtaagcactacattggcacccattcacccaagatccctatttctctcttccaaatcttcctctagcatgaagataagattgtacttatgataacgaattatctttttatttatacacatgaatatttagattctcaaagtgatggcggggatcaccggatctcgagcactcatggtggtggcgctcctctgcgctgccgcggccatgactgctgcacaagaagcatccaacgtgcgagccacgtatcattattacaacccacaacagaacaactgggacctgaacaaagtgagcgcatattgtgccacatgggatgccaacaaaccgttgtcttggcgccagaagtatggatggaccgccttctgtggacctgctggtcctaggggccgagactcgtgtggcaagtgtatccaggtattaaaattttcttcacattgacaaccgatttgtacttcaacattaaactgagtcgcttaaggatggtgtgctaaatttgtaggtgaagaaccggggaacaggtgcgacaataattgcgaggattgttgaccaatgcagcaatggtgggttggatctggactacgagaccatcttcaagaagatcgacacagatggtcgtggctaccagatgggtcacctccaggtcgattacaagttcgtcaattgttgatttggtcatgcctctttgcatgatcatatactggaataagaaatatatggtgttatacaataagatggaagaggttggcactctgtaatcatgctgaataatgaataaacgaaattacagttc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074722.1 RefSeq:Os11g0592200]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 11]]~~
−	~~[[Category:~~Chromosome 11]]

← Older revision		Revision as of 21:22, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os11g0592200\|		GeneName = Os11g0592200\|