Os12g0100500 - Revision history

Xysj2028 at 09:29, 8 May 2017

2017-05-08T09:29:42Z

Rice2012: /* References */

2015-06-13T09:09:33Z

‎References

Lmw2015: /* Structured Information */

2015-06-12T04:29:38Z

‎Structured Information

Strongpromoter: /* References */

2014-06-08T03:42:38Z

‎References

Strongpromoter: /* References */

2014-06-08T03:42:08Z

‎References

Strongpromoter: /* Annotated Information */

2014-06-08T03:40:32Z

‎Annotated Information

124.16.129.48 at 21:27, 22 July 2012

2012-07-22T21:27:47Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os12g0100500| Description = Alpha/beta hydrolase family protein| Version = NM_001071764.1 GI:115486849 GeneID:4351238| Length = 1294 bp| Defini..."

2012-06-21T10:18:02Z

Created page with "{{JaponicaGene| GeneName = Os12g0100500| Description = Alpha/beta hydrolase family protein| Version = NM_001071764.1 GI:115486849 GeneID:4351238| Length = 1294 bp| Defini..."

New page

{{JaponicaGene|
GeneName = Os12g0100500|
Description = Alpha/beta hydrolase family protein|
Version = NM_001071764.1 GI:115486849 GeneID:4351238|
Length = 1294 bp|
Definition = Oryza sativa Japonica Group Os12g0100500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
AP = Chromosome 12:11806..13099|
CDS = 11806..12363,12659..13099|
GCID = <gbrowseImage1>
name=NC_008405:11806..13099
source=RiceChromosome12
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008405:11806..13099
source=RiceChromosome12
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</cdnaseq>|
AA = <aaseq>MSSSSGGDGGGYNYSEDWVVNSRGMRLFTCAWIPKESSRGVVCL CHGYAVECSVTMRGTAERLARAGYAVHGIDYEGHGHSDGLQGYVPDLDALVRDCDSFF STATASFPRRRFLLGESMGGAVALLLHRLRPDFWTGAILVAPMCKIAEEMRPHPMVVS VLKVMTSIIPTWRVVPTNDVIDLAYRMQGKRDEIRGNPLCYKGRPRLKTAYELLRVSI LIESTILPHVSLPFLILHGAADRVTDPSVSDLLYRSASTTDKTFHLYTGMWHALTSGE LPHNIDAVFRDIIDWLHHRTSPTSASHVQDHDLSTSFEAERKAKHDDTIHCGKQTS</aaseq>|
DNA = <dnaseqindica>737..1294#1..441#atgagcagcagcagcggcggcgatgggggtgggtacaattactcggaggattgggtggtgaattcgcgagggatgcggctcttcacctgcgcgtggattcccaaggagagcagtagaggcgtggtttgcctgtgccatgggtacgcggtggagtgcagcgtgacgatgcgcggcacggcggagcggctggccagggcgggctacgccgtccacggcatcgactacgagggccacggccactccgacggcctccagggctacgtccccgacctcgacgccctcgtccgcgactgcgactccttcttctccaccgccaccgcctccttcccccgccgcagattcctcctcggcgagtccatgggcggcgccgtcgcccttcttctccaccgcttgcgccccgacttctggaccggcgccattctcgtcgcccccatgtgcaaggtccgttcaactccatcttaacctttgactctgacttttcctttttctttttgcccgccacatgcatgccatccacgaatcattcagtctacatatgcgtccccaagattagattagatatttagattatactacataacagaacaggctgtctctttctcattttctaagctacctaccggccggccactttcagattattatcttcttttaacgcaacgcaaggaaacgtttctgactgcctcaaatatcatggatgcatgtggttgaatactagtaaaatgcgtggttgcagatcgcggaggagatgcggccgcacccgatggtggtgagcgtgctgaaggtgatgacaagcatcataccgacgtggcgggtggtgccgacgaatgacgtgatcgacctggcatacaggatgcaggggaagcgagacgagatccgagggaacccactgtgctacaagggcaggccccgcctcaagaccgcctacgagctgctccgcgtcagcatcctcatcgagtccaccatcctcccccacgtctccctccccttcctcatcctccacggcgccgccgaccgggtcaccgacccctccgtcagcgacctcctctaccgctccgcctccaccaccgacaagaccttccacctctacaccggcatgtggcacgccctcacctccggcgaactccctcacaacatcgatgccgtcttccgcgacatcatcgactggctccaccacaggacatcccccacctccgcttcacatgtgcaggaccacgacttaagtacgtctttcgaggcggagcgcaaggccaagcacgacgacaccatccattgcggcaagcaaacatcatag</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071764.1 RefSeq:Os12g0100500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice gene '''''Os12g0100500''''' was not functionally studied yet.
 ==Annotated Information==
-''Os12g0100500'' in rice hasn't been studied. However, by running blast, we can find that query coverage is 100% with predicted protein [Hordeum vulgare subsp. vulgare]. This gene is predicted to be coding Lysophospholipase [Lipid metabolism]; COG2267.
+* ''Os12g0100500'' in rice hasn't been studied. However, by running blast, we can find that query coverage is 100% with predicted protein.
 ===Function===
-In enzymology, a lysophospholipase (EC 3.1.1.5) is an enzyme that catalyzes the chemical reaction
+* In enzymology, a lysophospholipase (EC 3.1.1.5) is an enzyme that catalyzes the chemical reaction
+* 2-lysophosphatidylcholine + H2O \rightleftharpoons glycerophosphocholine + a carboxylate
--lysophosphatidylcholine + H2O \rightleftharpoons glycerophosphocholine + a carboxylate
+* Thus, the two substrates of this enzyme are 2-lysophosphatidylcholine and H2O, whereas its two products are glycerophosphocholine and carboxylate.
-Thus, the two substrates of this enzyme are 2-lysophosphatidylcholine and H2O, whereas its two products are glycerophosphocholine and carboxylate.
+* This enzyme belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds.
 ===Evolution===
-Please input evolution information here.
+* This family consists of lysophospholipase / phospholipase B EC 3.1.1.5 and cytosolic phospholipase A2 which also has a C2 domain IPR000008.
 You can also add sub-section(s) at will.
@@ Line 21: / Line 25: @@
 ==References==
-[1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085.
+* [1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085.
-[2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.
+* [2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.
 [[Category:Genes]]

← Older revision		Revision as of 09:09, 13 June 2015
Line 30:		Line 30:
	[[Category:Japonica Chromosome 12]]		[[Category:Japonica Chromosome 12]]
	[[Category:Chromosome 12]]		[[Category:Chromosome 12]]
		+	== Structured Information ==

@@ Line 21: / Line 21: @@
 ==References==
 [1] Nalefski EA, Sultzman LA, Martin DM, Kriz RW, Towler PS, Knopf JL, Clark JD (1994). "Delineation of two functionally distinct domains of cytosolic phospholipase A2, a regulatory Ca(2+)-dependent lipid-binding domain and a Ca(2+)-independent catalytic domain". J. Biol. Chem. 269 (27): 18239–18249. PMID 8027085.
 [2]Jump up to: a b Lee KS, Patton JL, Fido M, Hines LK, Kohlwein SD, Paltauf F, Henry SA, Levin DE (1994). "The Saccharomyces cerevisiae PLB1 gene encodes a protein required for lysophospholipase and phospholipase B activity". J. Biol. Chem. 269 (31): 19725–19730. PMID 8051052.

@@ Line 22: / Line 22: @@
 ==References==
 Please input cited references here.
 ==Structured Information==

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Function===
-Please input function information here.
+In enzymology, a lysophospholipase (EC 3.1.1.5) is an enzyme that catalyzes the chemical reaction
 ===Expression===
 Please input expression information here.

← Older revision		Revision as of 21:27, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os12g0100500\|		GeneName = Os12g0100500\|