Os12g0101600 - Revision history

Lizhitao: /* References */

2014-05-31T13:22:34Z

‎References

Lizhitao: /* Labs working on this gene */

2014-05-31T13:21:01Z

‎Labs working on this gene

Lizhitao: /* References */

2014-05-30T14:38:21Z

‎References

Lizhitao at 14:09, 30 May 2014

2014-05-30T14:09:40Z

Lizhitao: /* Annotated Information */

2014-05-30T13:21:08Z

‎Annotated Information

Lizhitao: /* Annotated Information */

2014-05-30T13:14:28Z

‎Annotated Information

Lizhitao: /* Structured Information */

2014-05-30T09:41:20Z

‎Structured Information

Zhangzhang at 13:49, 28 May 2014

2014-05-28T13:49:50Z

Show changes

Lizhitao: /* Structured Information */

2014-05-28T04:51:34Z

‎Structured Information

Show changes

Lizhitao: /* Structured Information */

2014-05-28T04:32:33Z

‎Structured Information

@@ Line 28: / Line 28: @@
 == References ==
-. Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek
+* Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek.The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development New Phytologist, 2013, 198(4): 1071-1084
-  The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development
+*Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28.
-  New Phytologist, 2013, 198(4): 1071-1084
+*Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149
-.Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28.
+*Dai M, Hu Y, Zhao Y, Liu H, Zhou DX. 2007.AWUSCHEL-LIKE HOMEOBOXgene represses aYABBYgene expression required for rice leaf development.Plant Physiology144: 380–390
-.Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149
+*Zhang X, Madi S, Borsuk L, Nettleton D, Elshire RJ, Buckner B, JanickBuckner D, Beck J, Timmermans M, Schnable PSet al.2007.Laser microdissection of narrow sheath mutant maize uncovers novel gene expression in the shoot apical meristem.PLoS Genetics3: 1040–1052.

@@ Line 25: / Line 25: @@
 Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions.
 == Labs working on this gene ==
-*Histological analysis of leaves and spikelets
+*Department of Plant Science, Plant Genomics and Breeding Institute, Research Institute for Agriculture and Life Sciences, Seoul National University, Seoul, 151-921, Korea;Department of Molecular Biotechnology, Dong-A University, Busan, 604-714, Korea
 == References ==

← Older revision		Revision as of 14:38, 30 May 2014
Line 43:		Line 43:
	The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development		The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development
	New Phytologist, 2013, 198(4): 1071-1084		New Phytologist, 2013, 198(4): 1071-1084
		+	.Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28.
		+	.Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149
		+	. Dai M, Hu Y, Zhao Y, Liu H, Zhou DX. 2007.AWUSCHEL-LIKE HOMEOBOXgene represses aYABBYgene expression required for rice leaf development.Plant Physiology144: 380–390
		+	.Zhang X, Madi S, Borsuk L, Nettleton D, Elshire RJ, Buckner B, JanickBuckner D, Beck J, Timmermans M, Schnable PSet al.2007.Laser microdissection of narrow sheath mutant maize uncovers novel gene expression in the shoot apical meristem.PLoS Genetics3: 1040–1052.

← Older revision		Revision as of 14:09, 30 May 2014
Line 19:		Line 19:
	===Mutation===		===Mutation===
	narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.		narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.
		+
		+	=== Knowledge Extension ===
		+	map-based cloning to identifyNAL2and NAL3on chromosomes 11 and 12, respectively. They encode an identical OsWOX3A/OsNS protein that is homologous to NS of
		+	maize and PRS of Arabidopsis, all of which belong to the same WOX3subfamily (Figs S5b, S6; Zhang et al., 2007). Both NS andPRSplay an important role in the recruitment of founder cells for margin development of lateral organ primordia in monocots and eudicots, respectively (Nardmann et al., 2004). However, the functions ofNS/PRShomologues in other plant species remain unknown. Our histological and molecular studies show that in rice, OsWOX3Ais involved in differentiation of lemma and palea in spikelets, and tiller and LR production, in addition to lateral-axis expansion in leaves.
		+	Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions.
		+	== Labs working on this gene ==
		+	*Histological analysis of leaves and spikelets
		+	*Genetic and physical mapping of nal2and nal3
		+	*Membrane protein extraction and immunoblot analysis
		+	*Rice transformation and complementation
		+	*Histochemical analysis of OsWOX3A expression
		+	*RNA extraction, reverse transcription and quantitative real-time PCR (qRT-PCR)
		+	*Subcellular localization of the OsWOX3-GFP fusion protein in protoplasts
		+	*Transcriptional activation in the yeast GAL4 system
		+	*Scanning electron microscopy
		+	*Defects in lateral-axis outgrowth, margin development and vascular patterning during leaf development
		+	*Defective lemma and palea morphogenesis during spikelet development innal2/3
		+	*Map-based cloning ofnal2andnal3loci
		+	*OsWOX3Ain lamina outgrowth and vascular patterning
		+
		+	== References ==
		+	. Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek
		+	The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development
		+	New Phytologist, 2013, 198(4): 1071-1084

@@ Line 1: / Line 1: @@
 ==Annotated Information==
-narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.
+narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was
 ===Function===
 Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.

← Older revision		Revision as of 09:41, 30 May 2014
Line 16:		Line 16:
	===Mutation===		===Mutation===
	narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.		narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.
−
−	~~==Structured Information==~~
−	~~{{JaponicaGene\|~~
−	~~GeneName = Os12g0101600\|~~
−	~~Description = \|~~
−	~~Version = \|~~
−	~~Length = 612 bp \|~~
−	~~Source = Oryza sativa Japonica Group (Japanese rice) \|~~
−	~~ORGANISM = Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza. \|~~
−
−	~~Chromosome = [[:category:Japonica Chromosome 12\|Chromosome 12]]\|~~
−
−	~~CDNA =~~
−	~~<cdnaseq>1..612#~~
−	~~ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG~~
−	~~GAGATGTACAGGAGCGGCGTGCGAACGCCCAACGCGGCAGAGATCCAGCAAATCACGGCG~~
−	~~CACCTCGCCTACTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCAC~~
−	~~AAGGCCCGCGAGCGCCAGCGCCTCCGCCGCCGCCTCTGCGCGCGGCACCAGCAGCAACCC~~
−	~~TCACCGCCCTCCTCCACGGTGCCTCCGGCTCCCACTGCTGCTGCTGCCGGTGCCGTCGTG~~
−	~~CAGGTGCACCCCGCGGTGATGCAGCTACACCACCACCACCACCACCATCACCCATACGCT~~
−	~~GCGGCCGCCGCTGCCCAAAGTCATCACCTGCAGCAGCAGCAGCAGCAGCAAGCTGAGTGG~~
−	~~CCGGCGGCGGTGGACTACTGCAGCACTGCATCGGCGTCAGCGTCGGCAACTGCTGCTGAC~~
−	~~ATGGCGATCCCGCCGTGCTGCCGGCCGCTGAAAACGTTGGAGCTGTTCCCGACCAAGAGC~~
−	~~ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC~~
−	~~TCCACCAATTAA</cdnaseq> \|~~
−
−	~~AA = <aaseq>MPQTPSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNH~~
−	~~KARERQRLRRRLCARHQQQPSPPSSTVPPAPTAAAAGAVVQVHPAVMQLHHHHHHHHPYA~~
−	~~AAAAAQSHHLQQQQQQQAEWPAAVDYCSTASASASATAADMAIPPCCRPLKTLELFPTKS~~
−	~~TSGGLKEDCCSSSKSSSCSTSTN</aaseq>\|~~
−	~~Link = \|~~
−	}}

@@ Line 40: / Line 40: @@
 Predicted molecular weight:	22352.1
 Predicted pI:	8.7607
 Genomic Sequence
 >LOC_Os12g01120
 ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG
@@ Line 54: / Line 54: @@
 ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC
 TCCACCAATTAA
 CDS
 >LOC_Os12g01120.1
 ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG
@@ Line 68: / Line 68: @@
 ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC
 TCCACCAATTAA
 Protein
 >LOC_Os12g01120.1
 MPQTPSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNH