Os12g0603700 - Revision history

Rice2012: /* References */

2015-06-13T09:18:41Z

‎References

Lmw2015: /* Structured Information */

2015-06-12T04:35:53Z

‎Structured Information

Zhangye at 04:08, 29 January 2015

2015-01-29T04:08:13Z

Zhangye at 04:06, 29 January 2015

2015-01-29T04:06:17Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os12g0603700| Description = Protein kinase-like domain containing protein| Version = NM_001073746.1 GI:115489453 GeneID:4352728| Length = 1360 b..."

2012-06-21T10:36:28Z

Created page with "{{JaponicaGene| GeneName = Os12g0603700| Description = Protein kinase-like domain containing protein| Version = NM_001073746.1 GI:115489453 GeneID:4352728| Length = 1360 b..."

New page

{{JaponicaGene|
GeneName = Os12g0603700|
Description = Protein kinase-like domain containing protein|
Version = NM_001073746.1 GI:115489453 GeneID:4352728|
Length = 1360 bp|
Definition = Oryza sativa Japonica Group Os12g0603700, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
AP = Chromosome 12:25671309..25672668|
CDS = 25671309..25672079,25672096..25672668|
GCID = <gbrowseImage1>
name=NC_008405:25671309..25672668
source=RiceChromosome12
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008405:25671309..25672668
source=RiceChromosome12
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctgccatggacgcgaggaagaagaagagcggcggcggcggcggcgagccgcttctcggcaagtatgagcttgggcggatgcttgggcgagggacgttcgccaaggtgtacctggcgcgcgcggtggccggcggcgaggcggtggcggtgaaggtgatcgacaaggcggaggtgatgggcacggcgggcatggcgccgcgcgtgctccgggaggtggcggcgatgcggcggctgcgccacccgcacgtgctgcgcctccacgaggtgctcgccacgcgcgccaggatctacctcgtcatggagctcgccaccggcggcgacctcctgtcgaggctggcggcgctgccgcggcggcgcctgcccgagagcgcggcgcgccgggtgttcgtccagctcgtcgacgcgctgtcctactgccacgcgcgcggcgtggcgcaccgtgacgtgaagccgcagaacgtcctcctcgacggcgacggcaacctcaaggtctccgacttcggcctcgccgcgctcccgggacacgctccgcgacgacggccgcctccacaccgcgtgcggcacgccggcgtgctccgccgcagggcctacgacggcgccaaggccgacgcgtggtcgtgcggcgtcatcctcttcgtcctcctcgccggccacctccccttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgagctcccgcggtgggtgtcccagccggcgcgccgcctggtgagccgcctgctcgacccgaacccggacacccgcgtcgccgtcgagtcgctggcggcgcaccacccgtggttcaagcgctcgctcagcgtcgactcccagctcgacggcctcctcaacggcgagccagagcgcgccgtggcgttccaggcggcgccgccgccgccgctgaacgcgttcgacatcatctccatgtctcccgggctcgacctgtccgggctgttcggcgaacacgacaagagcctaagggagaagcggttcacgacgacggcgtcgccggagaagacgctggagcagctcggcctcgccggcgggaagctcgggtacgtggtggtggtggggaagaaaggggtggagtgcttgccgctggcgggggggcggctgtcgtcggggatcgccgcgatgtcggtggagatgtcggaggtggcgccgccgctgttgctcgtcgagctgaggctggaggtcgccgccggcgacgtcgacggcggcgacggcgaggtgaaggggtttgggtgggagcagctgagaatggagctaggtgatgtagttagggcttggcatagttgtgaggatttgtgtgaaatttag</cdnaseq>|
AA = <aaseq>MAAMDARKKKSGGGGGEPLLGKYELGRMLGRGTFAKVYLARAVA GGEAVAVKVIDKAEVMGTAGMAPRVLREVAAMRRLRHPHVLRLHEVLATRARIYLVME LATGGDLLSRLAALPRRRLPESAARRVFVQLVDALSYCHARGVAHRDVKPQNVLLDGD GNLKVSDFGLAALPGHAPRRRPPPHRVRHAGVLRRRAYDGAKADAWSCGVILFVLLAG HLPFDDSNIADMCRKAHRREYELPRWVSQPARRLVSRLLDPNPDTRVAVESLAAHHPW FKRSLSVDSQLDGLLNGEPERAVAFQAAPPPPLNAFDIISMSPGLDLSGLFGEHDKSL REKRFTTTASPEKTLEQLGLAGGKLGYVVVVGKKGVECLPLAGGRLSSGIAAMSVEMS EVAPPLLLVELRLEVAAGDVDGGDGEVKGFGWEQLRMELGDVVRAWHSCEDLCEI</aaseq>|
DNA = <dnaseqindica>590..1360#1..573#atggctgccatggacgcgaggaagaagaagagcggcggcggcggcggcgagccgcttctcggcaagtatgagcttgggcggatgcttgggcgagggacgttcgccaaggtgtacctggcgcgcgcggtggccggcggcgaggcggtggcggtgaaggtgatcgacaaggcggaggtgatgggcacggcgggcatggcgccgcgcgtgctccgggaggtggcggcgatgcggcggctgcgccacccgcacgtgctgcgcctccacgaggtgctcgccacgcgcgccaggatctacctcgtcatggagctcgccaccggcggcgacctcctgtcgaggctggcggcgctgccgcggcggcgcctgcccgagagcgcggcgcgccgggtgttcgtccagctcgtcgacgcgctgtcctactgccacgcgcgcggcgtggcgcaccgtgacgtgaagccgcagaacgtcctcctcgacggcgacggcaacctcaaggtctccgacttcggcctcgccgcgctcccgggacacgctccgcgacgacggccgcctccacaccgcgtgcggcacgccggcgtacgcggcgcccgaggtgctccgccgcagggcctacgacggcgccaaggccgacgcgtggtcgtgcggcgtcatcctcttcgtcctcctcgccggccacctccccttcgacgactccaacatcgccgacatgtgccggaaggcgcaccgccgcgagtacgagctcccgcggtgggtgtcccagccggcgcgccgcctggtgagccgcctgctcgacccgaacccggacacccgcgtcgccgtcgagtcgctggcggcgcaccacccgtggttcaagcgctcgctcagcgtcgactcccagctcgacggcctcctcaacggcgagccagagcgcgccgtggcgttccaggcggcgccgccgccgccgctgaacgcgttcgacatcatctccatgtctcccgggctcgacctgtccgggctgttcggcgaacacgacaagagcctaagggagaagcggttcacgacgacggcgtcgccggagaagacgctggagcagctcggcctcgccggcgggaagctcgggtacgtggtggtggtggggaagaaaggggtggagtgcttgccgctggcgggggggcggctgtcgtcggggatcgccgcgatgtcggtggagatgtcggaggtggcgccgccgctgttgctcgtcgagctgaggctggaggtcgccgccggcgacgtcgacggcggcgacggcgaggtgaaggggtttgggtgggagcagctgagaatggagctaggtgatgtagttagggcttggcatagttgtgaggatttgtgtgaaatttag</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001073746.1 RefSeq:Os12g0603700]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]

← Older revision		Revision as of 09:18, 13 June 2015
Line 52:		Line 52:
	[[Category:Japonica Chromosome 12]]		[[Category:Japonica Chromosome 12]]
	[[Category:Chromosome 12]]		[[Category:Chromosome 12]]
		+
		+	==Structured Information==

@@ Line 17: / Line 17: @@
 *''OsCIPK04'' peaked during the light period, the peak time of ''OsCIPK04'' was a little earlier than that of ''OsCIPK07'', suggesting the possibility of sequential regulation of circadian expression between them<ref name="ref1"/>.
-*The x-axis indicates sampling time used for real-time RT-PCR analysis and the y-axis indicates the relative expression level to OsUbi5. 2 h drought stress treated seedling leaves for 2 h, 2hc control for 2 h, 4 h drought stress treated seedling leaves for 4 h, 4hc control for 4 h, 6 h drought stress treated seedling leaves for 6 h, 6hc control for 6 h, 8 h drought stress treated seedling leaves
+*The x-axis indicates sampling time used for real-time RT-PCR analysis and the y-axis indicates the relative expression level to OsUbi5. 2 h drought stress treated seedling leaves for 2 h, 2hc control for 2 h, 4 h drought stress treated seedling leaves for 4 h, 4hc control for 4 h, 6 h drought stress treated seedling leaves for 6 h, 6hc control for 6 h, 8 h drought stress treated seedling leaves for 8 h, 8hc control for 8 h(Fig. 2)<ref name="ref1"/>.
 *Real-time RT-PCR analysis confirmed the diurnal expression patterns showing a peak at daytime and a downregulation in the ''osgi'' mutant for the three marker genes and nine of the ''OsCIPK'' genes, ''OsCIPK04'' is a member of these nine genes<ref name="ref1"/>.
@@ Line 26: / Line 25: @@
 ===Knowledge Extension===
-[[File: OsCIPK family Functional.png|right|thumb|260px|'''Figure 3.''' ''Functional gene network analysis of OsCIPK family members.(from reference <ref name="ref1"/>).'']]
+[[File: OsCIPK family Functional.png|left|thumb|260px|'''Figure 3.''' ''Functional gene network analysis of OsCIPK family members.(from reference <ref name="ref1"/>).'']]
 *From real-time RT-PCR analyses, ''Giong et al.'' identified 16 OsCIPK genes showing a significant up- or down-regulation in response to '''drought stress'''. Using the probable functional gene network tool, RiceNet, ''Giong et al.'' generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 3)<ref name="ref1"/>.
 *More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 3) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 3) under drought stress to all the elements in this network<ref name="ref1"/>.

← Older revision		Revision as of 04:06, 29 January 2015
Line 1:		Line 1:
		+	'''''OsCIPK04''''' is a member of '''CIPK genes''' (CIPKs,calcineurin B-like protein interacting protein kinases)<ref name="ref1"/>.
		+
		+	==Annotated Information==
		+	===Function===
		+	The function of ''OsCIPK04'' is '''specific to vegetative tissues/organs''' according to expression pattern. ''OsCIPK04'' might function downstream of ''OsGI''<ref name="ref1"/>.
		+
		+	'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0004672 GO:0004672],[http://amigo.geneontology.org/amigo/term/GO:0004674 GO:0004674], [http://amigo.geneontology.org/amigo/term/GO:0006468 GO:0006468], [http://amigo.geneontology.org/amigo/term/GO:0005524 GO:0005524], [http://amigo.geneontology.org/amigo/term/GO:0007165 GO:0007165]
		+
		+	===Expression===
		+	[[File: OsCIPK04 Expression1.jpg\|right\|thumb\|250px\|'''Figure 1.''' ''Validation of diurnal expression patterns for OsCIPK04.(from reference <ref name="ref1"/>).'']]
		+	[[File: OsCIPK04 Expression2.jpg\|right\|thumb\|250px\|'''Figure 2.''' ''Down-regulation in response to drought stress were analyzed through real-time RT-PCR analysis.(from reference <ref name="ref1"/>).'']]
		+
		+	*''OsCIPK04'' showed '''down-regulation''' under '''drought stress'''(Fig. 1)<ref name="ref1"/>.
		+
		+	*Of the two genes in subgroup VII, ''OsCIPK04'' showed preferred expression in the '''root and internode''' while ''OsCIPK07'' showed high expression in the '''root''', '''shoot''', and '''leaf''', which indicating that the function of both genes is '''specific to''' vegetative tissues/organs according to expression pattern<ref name="ref1"/>.
		+
		+	*''OsCIPK04'' peaked during the light period, the peak time of ''OsCIPK04'' was a little earlier than that of ''OsCIPK07'', suggesting the possibility of sequential regulation of circadian expression between them<ref name="ref1"/>.
		+
		+	*The x-axis indicates sampling time used for real-time RT-PCR analysis and the y-axis indicates the relative expression level to OsUbi5. 2 h drought stress treated seedling leaves for 2 h, 2hc control for 2 h, 4 h drought stress treated seedling leaves for 4 h, 4hc control for 4 h, 6 h drought stress treated seedling leaves for 6 h, 6hc control for 6 h, 8 h drought stress treated seedling leaves
		+	for 8 h, 8hc control for 8 h(Fig. 2)<ref name="ref1"/>.
		+
		+	*Real-time RT-PCR analysis confirmed the diurnal expression patterns showing a peak at daytime and a downregulation in the ''osgi'' mutant for the three marker genes and nine of the ''OsCIPK'' genes, ''OsCIPK04'' is a member of these nine genes<ref name="ref1"/>.
		+
		+	===Evolution===
		+	'''''OsCIPK04''''' and [[Os03g0634400\|'''''OsCIPK07''''']] belongs to '''Group VII''' of ''OsCIPK'' family<ref name="ref1"/>.
		+
		+	===Knowledge Extension===
		+	[[File: OsCIPK family Functional.png\|right\|thumb\|260px\|'''Figure 3.''' ''Functional gene network analysis of OsCIPK family members.(from reference <ref name="ref1"/>).'']]
		+	*From real-time RT-PCR analyses, ''Giong et al.'' identified 16 OsCIPK genes showing a significant up- or down-regulation in response to '''drought stress'''. Using the probable functional gene network tool, RiceNet, ''Giong et al.'' generated a hypothetical functional gene network based on 15 out of 16 OsCIPK proteins (Fig. 3)<ref name="ref1"/>.
		+	*More than 200 interactions mediated by these OsCIPK proteins. This network was further refined by integrating fold change data showing at least 1 log2-fold up-regulation (red colored nodes in Fig. 3) or less than -1 log2-fold down-regulation (green colored nodes in Fig. 3) under drought stress to all the elements in this network<ref name="ref1"/>.
		+	*Integrated subcellular localization data further enhances the feasibility of functional modules consisting of co-expressed functional groups such as CIPK and PPC and other components in the network(Fig. 3)<ref name="ref1"/>.
		+
		+	*The calcineurin B-like protein–CBL-interacting protein kinase ('''CBL–CIPK''') signaling pathway in plants is a Ca<sup>2+</sup>-related pathway that responds strongly to both abiotic and biotic environmental stimuli<ref name="ref2"/>. The CBL-CIPK system shows variety, specificity, and complexity in response to different stresses, and the CBL–CIPK signaling pathway is regulated by complex mechanisms in plant cells<ref name="ref2"/>.
		+
		+	==Labs working on this gene==
		+	*Department of Plant Molecular Systems Biotechnology & Crop Biotech Institute, Kyung Hee University, Yongin 446-701, Korea
		+	*Graduate School of Biotechnology, Kyung Hee University, Yongin 446-701, Korea
		+
		+	==References==
		+	<references>
		+	* <ref name="ref1">
		+	Giong H K, Moon S, Jung K H. A systematic view of the rice calcineurin B-like protein interacting protein kinase family[J]. Genes & Genomics, 2015, 37(1): 55-68.
		+	</ref>
		+	* <ref name="ref2">
		+	Yu Q, An L, Li W. The CBL–CIPK network mediates different signaling pathways in plants[J]. Plant cell reports, 2014, 33(2): 203-214.
		+	</ref>
		+	</references>
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os12g0603700\|		GeneName = Os12g0603700\|

@@ Line 46: / Line 46: @@
 </references>
 [[Category:Genes]]
 [[Category:Japonica mRNA]]