Os12g0641400 - Revision history

Xysj2012: /* References */

2017-03-21T08:53:20Z

‎References

Xysj2012: /* References */

2017-03-21T08:53:12Z

‎References

Liman: /* Subcellular localization */

2016-06-12T05:56:32Z

‎Subcellular localization

Liman: /* Subcellular localization */

2016-06-12T05:56:10Z

‎Subcellular localization

Liman: /* Evolution */

2016-06-12T05:55:51Z

‎Evolution

Liman: /* Expression Pattern */

2016-06-12T05:55:28Z

‎Expression Pattern

Liman at 05:53, 12 June 2016

2016-06-12T05:53:14Z

192.168.72.52 at 03:50, 15 May 2015

2015-05-15T03:50:58Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os12g0641400| Description = Similar to Sucrose transporter| Version = NM_001190153.1 GI:297729436 GeneID:9266530| Length = 4118 bp| Definition ..."

2012-06-21T10:39:08Z

Created page with "{{JaponicaGene| GeneName = Os12g0641400| Description = Similar to Sucrose transporter| Version = NM_001190153.1 GI:297729436 GeneID:9266530| Length = 4118 bp| Definition ..."

New page

{{JaponicaGene|
GeneName = Os12g0641400|
Description = Similar to Sucrose transporter|
Version = NM_001190153.1 GI:297729436 GeneID:9266530|
Length = 4118 bp|
Definition = Oryza sativa Japonica Group Os12g0641400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
AP = Chromosome 12:27740433..27744550|
CDS = 27742765..27742791,27743991..27744203,27744223..27744495|
GCID = <gbrowseImage1>
name=NC_008405:27740433..27744550
source=RiceChromosome12
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008405:27740433..27744550
source=RiceChromosome12
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgccgcggcggcctagcggcggcggcggcggcgctggtcccgcggcggccgcggtgcgcaaggtccccctgcggaagcttctgcgtgcggcgtcggtggcgtgcggcgtgcagttcgggtgggcgctgcagctctccctgctgaccccctacgtccaggagctcggcatcccgcacgccttcgccagcctcgtctggctctgcggccccctctccggcctcctcgtccagcccctcgtcggccacctctccgaccgcatcgcccccgccgccgccccttcatcgccgccggcgccgcttccatcgctgccgcagttctcaccgtcggattctccgccgacctcggccgaatcttcggcgattccatcaccccgggctccacccgcctcggcgccatcatcgtctacctcgtcggcttctggctcctcgacgtcggcaacaacgctacacagggaccctgcagggccttcctcgccgacctcaccgagaatgacccaaggaggactcggatag</cdnaseq>|
AA = <aaseq>MPRRPSGGGGGAGPAAAAVRKVPLRKLLRAASVACGVQFGWALQ LSLLTPYVQELGIPHAFASLVWLCGPLSGLLVQPLVGHLSDRIAPAAAPSSPPAPLPS LPQFSPSDSPPTSAESSAIPSPRAPPASAPSSSTSSASGSSTSATTLHRDPAGPSSPT SPRMTQGGLG</aaseq>|
DNA = <dnaseqindica>1760..1786#348..560#56..328#tcttctgaactaacccaaagatcaggtcggaggcggaggcaaacacgagaagaagatgccgcggcggcctagcggcggcggcggcggcgctggtcccgcggcggccgcggtgcgcaaggtccccctgcggaagcttctgcgtgcggcgtcggtggcgtgcggcgtgcagttcgggtgggcgctgcagctctccctgctgaccccctacgtccaggagctcggcatcccgcacgccttcgccagcctcgtctggctctgcggccccctctccggcctcctcgtccagcccctcgtcggccacctctccgaccgcatcgcccccgccgcctcccccctcggccgccgccgccccttcatcgccgccggcgccgcttccatcgctgccgcagttctcaccgtcggattctccgccgacctcggccgaatcttcggcgattccatcaccccgggctccacccgcctcggcgccatcatcgtctacctcgtcggcttctggctcctcgacgtcggcaacaacgctacacagggaccctgcagggccttcctcgccgacctcaccggtatctatctaccctacctaccatcgattgcttgattgattgctagcttgcttgcttcccaactttcgcatcgaacagccaagaggaattggaattggacctcgcttccgccacaagccacacctgctcatcttttcgattccgtccaattgcgaaacgtaggaccaaacttcaaaacaatttcctctttttcttttttttttcttatgtggctgtatgtgtggctgtgtgtggacacaacacaacagcagcctgcctctgcgtatcgctttcccctttagcctgcctgcctgagattcttgctccgatggatgctggtcggcgtaactcattttgcttgtctccctaaaaattatattatatatttcctcttcatttgtttatttattttacggccatggttttttgtttgccctgccagctggcctattattagcatcagggttaggcgagctggacaacacgaaccacaaaacgacatgacaactcattacactgcatatatttgaataattagggttggtacaaatgtcgcaccaattgtttttttttcatttcttccttgtagttttttttttcatttcttccttgtttacacggagtattcgatggttgtgggagggggaggtcaagggatcgctttctgactgagataggaatatagaaaggaagatatttgagtgttacagtacccctgtaagtttggaatcataggaggagaaagagcatcttttgtcagcagacagggctattgtctgaggggccctggttaaataattgtaaggctggcagtggtttgtagctgtggtctttgttatgcctttgcattctatgggaaacacctgatgcaaacattacattcagaaggcatgattgtgctttttgtcatggaaatgctggagttccacggtaaattggtgataaaattgatatgattgtaatattactccatgatcttctgtttaggcagtcaaattcagctggcacgatctccattatccaatgcatgtggatatgtgcatacaagagcttttcagatattcttaacttgtagttgcacatgcctgtcctcaaatttttcccagtaatgtttacaccaataacccatctgtgcaatgtaacgtgttcgaaaggcatcgtaattgcattagcatttttccacacctcgtaaatgctcattctgatcctttctatttcagagaatgacccaaggaggactcggatagctaatgcttacttctcattgttcatggccctgggaaacatacttggatatgccactggagcatacagtggctggtacaagatattcccgttcaccgttactccatcatgtagcatcagctgtgccaacctcaagtctgcctttctacttgatattatcattttggtggtcactacatgcatcactgtagcatcagtgcaagagcctcaatcctttggaagtgatgaagcagatcaccctagcacagaacaggaagctttcctctgggaactttttggatcattccggtactttacattaccggtttggatggttttgattgttactgccctcacatggattggatggtttccatttatcctctttgataccgattggatgggtcgagagatctatcgtggaagtccagatgatccaagtataactcagagctatcatgatggtgtgagaatgggttcttttggtctgatgctgaactcggtccttcttggattcacttctattgtactagagaagttatgtcggaagtggggagctggactggtgtggggtgtctccaatatcctaatggcattgtgctttgtggcaatgcttgtaataacatatgtggcaaagaatatggattatccacctagtggagtaccaccaaccggcattgtcattgcttccctggtagtttttacaattttaggagcgcccctggcggtgagtaacaattttttccctccagagtttcttcaagttctcactggtgtatggtatccttattaattcttgttattgcagatcacgtacagtataccatatgcaatggctgctagtcgggttgaaaatctgggacttggccaaggtactgttccttttgagtcaatgctatcattttgggttcctgtacttaggaagtctttgtttcacatgcaggtctagcaatgggcattcttaatttggctattgtcataccacaggtatgtatttcttgcctttttttctctttgttttagagtttgattcgttcaaacatatgactgtaacacagtacaattatgaatattgacatgattgctgtatcctaaaataacctgttgatggtggaaacttacttaattcatggctcaaccacagttatcagacacaatttaagaaatggtttaatggttaattgtaagctatgacctgccgtcgaccatgtcaaaacaaccatatactgcataatttactaagtaggataactagtcatactggtacaagtaaatttgttatgaaaaacaatgctttcacagtattgtgctgacctccgaaatcatttactttcgtgctaactttgttaaggcacaatgaatataatttagtagtcatggtgttatcttattgacttcgagaaatcaaaagccaatttacttgagtgaaagtgtgaactcaggaataattgtgttatgtaagctagatacattttgtgagctacagcatgagaaatcattctcttacaaatttagtatactgtgagtgccatcatggtagttgaaatttaaaaggttgaatccctgatggaagattacaagttcaggattggcacaatttgccctgatttacgggctacagaatatatgagggatttagtagttggatgtcaaccattcgcttgttgctactacaaagcttccatgctattccagaaaattactttcatacattaggttatcgtgcatgtactgacactggtacattcaggttattgtgtcactgggtagcgggccctgggaccaactgtttggtggtggcaatgcaccagcctttgcagtggctgctgctgcatcttttatcggtgggctggtggctattctgggccttccacgagcccgcattgcatcaaggaggagaggtcaccgataagaatattgctacatataaattgtcggccattctttgcaattcgactcataagaggcactcggaacgctatgcagtgcatgggggaattgtatattatctccgaatcaagaaggggataatgcttgctttctccatgagctatttttgcctttttcatgccggatcatcatatgctgtcgtacattggatgatcttatgctgttgtacattggatgttggtcatttgtagagatactagtgaataaaagttgcaggagttggttcactcgagaaaattctggtcagtatgtcgtccatctgctgcacgacagcagttaggagccgaatagcatgtccatgggttttcatcaaatgttgtatcatcatttgttttttgatacgttcagacggcttcagtgctgtgtgaatatatatgtatggaatatatcgagaaaatgttgttg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001190153.1 RefSeq:Os12g0641400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]

@@ Line 62: / Line 62: @@
 </references>
-<br><br>
+<br>
 [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]

← Older revision		Revision as of 08:53, 21 March 2017
Line 62:		Line 62:
	</references>		</references>

−	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]	+	<br><br>
		+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]

@@ Line 23: / Line 23: @@
 ===Subcellular localization===
 * OsSUT2 encodes a putative sucrose transporter containing 12 transmembrane domains in rice plants. Subcellular localization of the OsSUT2::GFP fusion protein indicated that OsSUT2 is a cell membrane protein(Figure 3,4).<ref name="ref 1" /><br>[[File:Sut-1.png|left|thumb|300px|'''Figure 3.''' Alignment of amino acid sequences from potato SUT4 (StSUT4; Genbank accession AF237780), tomato SUT4 (LeSUT4; AF176950), Arabidopsis SUT4 (AtSUT4; AY072092), and rice OsSUT2 (HQ875341). TM transmembrane domain. <ref name="ref 1" />.'']]
-[[File:Sut-2.PNG|center|thumb|320px|'''Figure 4.''' Comparison of SUT protein structures. The inside and outside membrane regions and transmembrane domains of OsSUT2, StSUT4, AtSUT4, LeSUT4, AtSUT2 (AK226970), and LeSUT2 (AF166498) were predicted using TMMOD software. <ref name="ref 1" />.'']]
+[[File:Sut-2.png|center|thumb|320px|'''Figure 4.''' Comparison of SUT protein structures. The inside and outside membrane regions and transmembrane domains of OsSUT2, StSUT4, AtSUT4, LeSUT4, AtSUT2 (AK226970), and LeSUT2 (AF166498) were predicted using TMMOD software. <ref name="ref 1" />.'']]
 * The expression of OsSUT2-GFP fusion protein was observed in the aleurone layer cells of barley seeds. Fluorescence imaging showed that the fusion protein was localized on the plasma membrane.(Figure 5)<ref name="ref 1"/>

@@ Line 22: / Line 22: @@
 ===Subcellular localization===
-* OsSUT2 encodes a putative sucrose transporter containing 12 transmembrane domains in rice plants. Subcellular localization of the OsSUT2::GFP fusion protein indicated that OsSUT2 is a cell membrane protein(Figure 3,4).<ref name="ref 1" /><br>[[File:Sut-1.PNG|left|thumb|300px|'''Figure 3.''' Alignment of amino acid sequences from potato SUT4 (StSUT4; Genbank accession AF237780), tomato SUT4 (LeSUT4; AF176950), Arabidopsis SUT4 (AtSUT4; AY072092), and rice OsSUT2 (HQ875341). TM transmembrane domain. <ref name="ref 1" />.'']]
+* OsSUT2 encodes a putative sucrose transporter containing 12 transmembrane domains in rice plants. Subcellular localization of the OsSUT2::GFP fusion protein indicated that OsSUT2 is a cell membrane protein(Figure 3,4).<ref name="ref 1" /><br>[[File:Sut-1.png|left|thumb|300px|'''Figure 3.''' Alignment of amino acid sequences from potato SUT4 (StSUT4; Genbank accession AF237780), tomato SUT4 (LeSUT4; AF176950), Arabidopsis SUT4 (AtSUT4; AY072092), and rice OsSUT2 (HQ875341). TM transmembrane domain. <ref name="ref 1" />.'']]
 [[File:Sut-2.PNG|center|thumb|320px|'''Figure 4.''' Comparison of SUT protein structures. The inside and outside membrane regions and transmembrane domains of OsSUT2, StSUT4, AtSUT4, LeSUT4, AtSUT2 (AK226970), and LeSUT2 (AF166498) were predicted using TMMOD software. <ref name="ref 1" />.'']]
 * The expression of OsSUT2-GFP fusion protein was observed in the aleurone layer cells of barley seeds. Fluorescence imaging showed that the fusion protein was localized on the plasma membrane.(Figure 5)<ref name="ref 1"/>
-[[File:Sut-3.PNG|right|thumb|320px|'''Figure 5.'''  Subcellular localization of OsSUT2 by transient expression of OsSUT2-GFP fusion proteins in barley aleurone layer cells. a Bright field image. b GFP fluorescence image. c Merged field and fluorescence image. <ref name="ref 1" />.'']]
+[[File:Sut-3.png|right|thumb|320px|'''Figure 5.'''  Subcellular localization of OsSUT2 by transient expression of OsSUT2-GFP fusion proteins in barley aleurone layer cells. a Bright field image. b GFP fluorescence image. c Merged field and fluorescence image. <ref name="ref 1" />.'']]
 * OsSUT2 contains 12 transmembrane domains and was localized on plasma membrane. Amino acid alignment showed that the number of amino acids in the central inside loops are similar among OsSUT2 and other SUTs in group 4. The length of the OsSUT2 central loop is shorter than that of SUTs belonging to group 2, i.e., AtSUT2 and LeSUT2. LeSUT2 is considered to function as a putative sucrose sensor.<ref name="ref 1"/>

@@ Line 19: / Line 19: @@
 * Based on a previous phylogenetic analysis of the SUT gene family by Braun and Slewinski, OsSUT2 was grouped with Arabidopsis. AtSUT4 is also classified with StSUT4 and LeSUT4 in the same group. The amino acid identities between OsSUT2 and StSUT4, LeSUT4, and AtSUT4 are 66%, 66%, and 64%.<ref name="ref 1"/>
 * In the plant SUT protein family, OsSUT1, 3, 4 and 5 are clustered together with members of the dicot-SUT2 group, forming the Type-II subfamily. Within this subfamily OsSUT1 and the orthologues from other cereal species form the cereal (monocot) -SUT1 group, sharing at least 80% identity to one another. OsSUT3 and OsSUT5 are mapped separately in the Type-II subfamily. OsSUT4 seems to be the rice orthologue of the dicot-SUT2 proteins, sharing 58–63% identity and the common features of an extended N-terminal and central loop. OsSUT2, together with HvSUT2, is closely related to dicot-SUT4 group, forming the Type-III subfamily.(Figure 2)<ref name="ref 2"/>
-[[File:Sut-5.PNG|center|thumb|300px|'''Figure 2.''' An un-rooted dendrogram of plant SUTs, based on deduced amino acid sequences. The CLUSTALW program was used to show the relationship between the members of the OsSUT gene family (bold) and other plant SUTs.<ref name="ref 1"/>'']]
+[[File:Sut-5.png|center|thumb|300px|'''Figure 2.''' An un-rooted dendrogram of plant SUTs, based on deduced amino acid sequences. The CLUSTALW program was used to show the relationship between the members of the OsSUT gene family (bold) and other plant SUTs.<ref name="ref 1"/>'']]
 ===Subcellular localization===

@@ Line 13: / Line 13: @@
 * Based on OsSUT2 promoter::GUS expression in germinating seeds of transgenic rice, OsSUT2 was signifi-cantly expressed in the embryos and aleurone layers.  In embryos, strong GUS expression was detected in the scutellum and vascular bundle tissues. Developmental stage- and sugar-dependent OsSUT2 expression was suggested to be controlled by transcriptional regulation of the promoter region.<ref name="ref 1"/><br><br>
 * Expression of OsSUT2-green fluorescent protein in rice revealed that OsSUT2 localizes to the tonoplast. Analysis of the OsSUT2 promoter::b-glucuronidase transgenic rice indicated that this gene is highly expressed in leaf mesophyll cells, emerging lateral roots, pedicels of fertilized spikelets, and cross cell layers of seed coats.(Figure 1)<ref name="ref 2"/><br><br>
-[[File:Sut-4.PNG|right|thumb|300px|'''Figure 1.''' Changes in OsSUT2 expression in embryos during seed germination. The data are presented as mean±SD.<ref name="ref 1"/>'']]
+[[File:Sut-4.png|right|thumb|300px|'''Figure 1.''' Changes in OsSUT2 expression in embryos during seed germination. The data are presented as mean±SD.<ref name="ref 1"/>'']]
 * Carbohydrate transport from endosperms and embryos to coleoptiles, shoots, and roots is an important process for supplying developing tissues with a carbon source during seed germination and seedling establishment. The levels of OsSUT2 mRNA gradually increased from 1 to 5 DAI.(Figure 1.)<ref name="ref 1"/><br><br>

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+Gene Os12g0641400,namely '''OsSUT2''',means sucrose transporter.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+* '''OsSUT2''' (Os12g0641400)  The ossut2 mutant exhibited a growth retardation phenotype with a significant reduction in tiller number, plant height, 1,000-grain weight, and root dry weight compared with the controls, the wild type, and complemented transgenic lines. Analysis of primary carbon metabolites revealed that ossut2 accumulated more Suc, glucose, and fructose in the leaves than the controls. Further sugar export analysis of detached leaves indicated that ossut2 had a significantly decreased sugar export ability compared with the controls. These results suggest that OsSUT2 is involved in Suc transport across the tonoplast from the vacuole lumen to the cytosol in rice, playing an essential role in sugar export from the source leaves to sink organs.<ref name="ref 1"/><br><br>
-===Expression===
+===Expression Pattern===
-Please input expression information here.
+* In embryos of germinating seeds, the expression of OsSUT2 gradually increased during the early germinating stage.  The developmental regulations of OsSUT2 in germinating embryos could be mediated by sugars transported from endosperms. OsSUT2 expression was up-regulated by glucose through a hexokinase-independent pathway.<ref name="ref 1"/><br><br>
 ===Evolution===
-Please input evolution information here.
+* Based on a previous phylogenetic analysis of the SUT gene family by Braun and Slewinski, OsSUT2 was grouped with Arabidopsis. AtSUT4 is also classified with StSUT4 and LeSUT4 in the same group. The amino acid identities between OsSUT2 and StSUT4, LeSUT4, and AtSUT4 are 66%, 66%, and 64%.<ref name="ref 1"/>
-You can also add sub-section(s) at will.
+===Subcellular localization===
 ==Labs working on this gene==
-Please input related labs here.
+*Naohiro Aoki, Graham N. Scofield, Paul R. Whitfeld:CSIRO Plant Industry, Canberra, ACT, 2601 Australia<br>
 ==References==
-Please input cited references here.
+<references>
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]

@@ Line 1: / Line 1: @@
-{{JaponicaGene|
+Please input one-sentence summary here.
-  ORGANISM  Oryza sativa Japonica Group
+==Annotated Information==
-            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+===Function===
-            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
+Please input function information here.
-            clade; Ehrhartoideae; Oryzeae; Oryza.
+===Expression===
-Chromosome = [[:category:Japonica Chromosome 12|Chromosome 12]]|
+Please input expression information here.
-AP = Chromosome 12:27740433..27744550|
-CDS = 27742765..27742791,27743991..27744203,27744223..27744495|
+===Evolution===
-GCID = <gbrowseImage1>
+Please input evolution information here.
-name=NC_008405:27740433..27744550
-source=RiceChromosome12
+You can also add sub-section(s) at will.
-preset=GeneLocation
-</gbrowseImage1>|
+==Labs working on this gene==
-GSID = <gbrowseImage2>
+Please input related labs here.
-name=NC_008405:27740433..27744550
-source=RiceChromosome12
+==References==
-preset=GeneLocation
+Please input cited references here.
-</gbrowseImage2>|
-CDNA = <cdnaseq>atgccgcggcggcctagcggcggcggcggcggcgctggtcccgcggcggccgcggtgcgcaaggtccccctgcggaagcttctgcgtgcggcgtcggtggcgtgcggcgtgcagttcgggtgggcgctgcagctctccctgctgaccccctacgtccaggagctcggcatcccgcacgccttcgccagcctcgtctggctctgcggccccctctccggcctcctcgtccagcccctcgtcggccacctctccgaccgcatcgcccccgccgccgccccttcatcgccgccggcgccgcttccatcgctgccgcagttctcaccgtcggattctccgccgacctcggccgaatcttcggcgattccatcaccccgggctccacccgcctcggcgccatcatcgtctacctcgtcggcttctggctcctcgacgtcggcaacaacgctacacagggaccctgcagggccttcctcgccgacctcaccgagaatgacccaaggaggactcggatag</cdnaseq>|
+==Structured Information==
-AA = <aaseq>MPRRPSGGGGGAGPAAAAVRKVPLRKLLRAASVACGVQFGWALQ                     LSLLTPYVQELGIPHAFASLVWLCGPLSGLLVQPLVGHLSDRIAPAAAPSSPPAPLPS                     LPQFSPSDSPPTSAESSAIPSPRAPPASAPSSSTSSASGSSTSATTLHRDPAGPSSPT                     SPRMTQGGLG</aaseq>|
+     [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 12]]