OsMYB103L - Revision history

Hijikatakaede: /* Structural Information */

2014-06-11T08:14:16Z

‎Structural Information

Hijikatakaede at 08:08, 11 June 2014

2014-06-11T08:08:33Z

Hijikatakaede at 07:21, 11 June 2014

2014-06-11T07:21:30Z

Hijikatakaede: /* References */

2014-06-11T06:58:33Z

‎References

Hijikatakaede at 06:52, 11 June 2014

2014-06-11T06:52:59Z

Hijikatakaede at 06:21, 11 June 2014

2014-06-11T06:21:25Z

Hijikatakaede at 06:19, 11 June 2014

2014-06-11T06:19:40Z

Hijikatakaede at 06:18, 11 June 2014

2014-06-11T06:18:16Z

Hijikatakaede at 05:58, 11 June 2014

2014-06-11T05:58:56Z

Hijikatakaede at 05:55, 11 June 2014

2014-06-11T05:55:09Z

← Older revision		Revision as of 08:14, 11 June 2014
Line 95:		Line 95:

	==Structural Information==		==Structural Information==
		+	{{JaponicaGene\|
		+	GeneName = Os08g0151300\|
		+	Description = Myb, DNA-binding domain containing protein\|
		+	Version = NM_001067532.1 GI:115474800 GeneID:4344665\|
		+	Length = 2820 bp\|
		+	Definition = Oryza sativa Japonica Group Os08g0151300, complete gene.\|
		+	Source = Oryza sativa Japonica Group
		+
		+	ORGANISM Oryza sativa Japonica Group
		+	Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
		+	Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
		+	clade; Ehrhartoideae; Oryzeae; Oryza.
		+	\|
		+	Chromosome = [[:category:Japonica Chromosome 8\|Chromosome 8]]\|
		+	AP = Chromosome 8:2947556..2950375\|
		+	CDS = 2947987..2948803,2949733..2949862,2950026..2950158\|
		+	GCID = <gbrowseImage1>
		+	name=NC_008401:2947556..2950375
		+	source=RiceChromosome08
		+	preset=GeneLocation
		+	</gbrowseImage1>\|
		+	GSID = <gbrowseImage2>
		+	name=NC_008401:2947556..2950375
		+	source=RiceChromosome08
		+	preset=GeneLocation
		+	</gbrowseImage2>\|
		+	CDNA = <cdnaseq>atggggcatcactcttgctgcaaccagcagaaggtgaagaggggcctctggtctcctgaggaagatgagaagctcatcagatacatcaccacccatggctatggctgctggagcgaggtcccggagaaagccggtttgcagcgatgtgggaagagctgccggctccggtggatcaactacctgagaccggacatccggcgagggcggttcacggcggaggaggagaagctcatcatcagcctgcacgccattgttggcaacaggtgggcccacattgccagccacctgcctggccggaccgacaacgagatcaagaactactggaattcatggatcaagaagaagattcgcaagccggcggcggccgccgccgcggcgaccacgacgagcccgaacaacccgccgccgtgcagcacggcgacgtcggaccaccaccacctgccgccgccggcgttcggcggcgctgatcaccacctgcagctcgacgccatcatcaaccagaacctgatatcatccctgccgccgaagctcgccaccggcgacgactcgccgccggcggtgcccgggctgccgcaccactgcccgctcttcatgttcgacaccaccaccaccggcgccggcggcgccatcagcccgccgccgccgtcatcactgatcccaacccacctccaccaccaccaccacccgttcatcgccagcttcacggcggcgatggccgccgacacgccgagctacctgcccccgctggtcgacggcatggcagccatgggagcggccatggattgcagcttagaagatggccaaacagccgccgccatggccgccaccaatggctactaccagcatcatcagaagcatcagcagctggagattgagctggaggaggaggagcagaggcagctagggcatcatcatcatcagcatcaccatgagcatgagcatgaaaatcatcagtgggatgaagaagaagcacagcatctgctgatgtgggatcaagaagtactaacatcatccaacttggaggccatgcaaagtggtgctcattccctcctttttatgggaccaaatgaccatgattaa</cdnaseq>\|
		+	AA = <aaseq>MGHHSCCNQQKVKRGLWSPEEDEKLIRYITTHGYGCWSEVPEKA GLQRCGKSCRLRWINYLRPDIRRGRFTAEEEKLIISLHAIVGNRWAHIASHLPGRTDN EIKNYWNSWIKKKIRKPAAAAAAATTTSPNNPPPCSTATSDHHHLPPPAFGGADHHLQ LDAIINQNLISSLPPKLATGDDSPPAVPGLPHHCPLFMFDTTTTGAGGAISPPPPSSL IPTHLHHHHHPFIASFTAAMAADTPSYLPPLVDGMAAMGAAMDCSLEDGQTAAAMAAT NGYYQHHQKHQQLEIELEEEEQRQLGHHHHQHHHEHEHENHQWDEEEAQHLLMWDQEV LTSSNLEAMQSGAHSLLFMGPNDHD</aaseq>\|
		+	DNA = <dnaseqindica>1573..2389#514..643#218..350#aagagaaggtagctcatgcatattaaaagggctaaacaccaaccaaaccctttgctcctccatgacaacaatgtcatgttgctagcagctagatcaagaatatattcaagatagttaattgctgcatataggttttgcaagttgcagaacttgcagctatattgttgttacactagctgttcatatcttggattccagtgatatctagagtgcatgcatggggcatcactcttgctgcaaccagcagaaggtgaagaggggcctctggtctcctgaggaagatgagaagctcatcagatacatcaccacccatggctatggctgctggagcgaggtcccggagaaagccggtacgccgcatatcgtcgatcgatcgattaatcccccaatatcttgattgattgatgaacattcaatgagatggatgaactatcattgcttgattgatgaacattttcttgaggaactgatctgtcaattgctgaattgtgtgcaatgtggtggtttgtgaaggtttgcagcgatgtgggaagagctgccggctccggtggatcaactacctgagaccggacatccggcgagggcggttcacggcggaggaggagaagctcatcatcagcctgcacgccattgttggcaacaggtaggttcttgcatgcagcagcagcaacacgatgatcagttagttcatggtgaccttattattagtacctaccaagtactacctaatcgagctataattattcttctctaaattcttgattaatttcgaagattccccaattcccccaaagtagagatatgcatggcatttgatcaaattttgctgtttttcttgcaatttgatgattgcattacatcctaggctcagctaattgactgatattatctagaaaaatctgtttgaatgatgtgttactgttcttcggcaatgacgactatctatctccattgctgccctgtcatcaacaattgctgtcgatgctcctattcttctgaatttttttcctccttttgcttcattttcagttcactgtaatatcgatttaacaatcgataatcccgtcagtgacacatcacatgacaaaagtgatatgaaatttcctcaaaagataattaaaggtgattctgaagtgtcctagtatggtacttatatatggccctcagagcttgattatgctaattttcccaagatttttcgatttttctccgttaaaattaagttgaaaggagcaagtcatcatgttgacgtcaagcatgacaaatcgtattagccgtcgttttctacttgtttagcttgaacacgacgattataacaaatcaagccgtacatgagagtagcattacttctaaacaaagggttccaaattaagtgtacatacagcatcacacaactatattatattcttgaattcaatatatatacatagtatatatatctatagtaccaacttgattgatcattagtcgcatgattaatttgaccaagatatgatggtgtgtagtatcagtatataaaccatagagagaataattaactaattataattaatgttgttgtctctctgacaggtgggcccacattgccagccacctgcctggccggaccgacaacgagatcaagaactactggaattcatggatcaagaagaagattcgcaagccggcggcggccgccgccgcggcgaccacgacgagcccgaacaacccgccgccgtgcagcacggcgacgtcggaccaccaccacctgccgccgccggcgttcggcggcgctgatcaccacctgcagctcgacgccatcatcaaccagaacctgatatcatccctgccgccgaagctcgccaccggcgacgactcgccgccggcggtgcccgggctgccgcaccactgcccgctcttcatgttcgacaccaccaccaccggcgccggcggcgccatcagcccgccgccgccgtcatcactgatcccaacccacctccaccaccaccaccacccgttcatcgccagcttcacggcggcgatggccgccgacacgccgagctacctgcccccgctggtcgacggcatggcagccatgggagcggccatggattgcagcttagaagatggccaaacagccgccgccatggccgccaccaatggctactaccagcatcatcagaagcatcagcagctggagattgagctggaggaggaggagcagaggcagctagggcatcatcatcatcagcatcaccatgagcatgagcatgaaaatcatcagtgggatgaagaagaagcacagcatctgctgatgtgggatcaagaagtactaacatcatccaacttggaggccatgcaaagtggtgctcattccctcctttttatgggaccaaatgaccatgattaagttggtaataataacctatgtctaccccccccccaattttttttctttttgggaaaaaaaaacttgcatgtgcatattttgcatctcacaacatctgatcccatctctgatctgatcttgatctccctttgatcaatctagctctcactactaccccatctgatctgtctatacatgaaataatgaggttttgcaaattaaaggcgcgcgtaatttattgtgttttggattttttttctatctctctccaagagcttttattttggtttttttacttttttttttggattggagtgtgaagactgaatagtgtgtgtcaattgggttttttgtaaagagaccaccttgtatgagtgcatggcatggcactttggagtgtgtaatttgattgatgtatctaagtgaatttataataaacacaggaggatgac</dnaseqindica>\|
		+	Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001067532.1 RefSeq:Os08g0151300]\|
		+	}}
		+	[[Category:Genes]]
		+	[[Category:Japonica mRNA]]
		+	[[Category:Oryza Sativa Japonica Group]]
		+	[[Category:Japonica Genes]]
		+	[[Category:Japonica Chromosome 8]]
		+	[[Category:Chromosome 8]]

@@ Line 6: / Line 6: @@
 ===Function===
-OsMYB103L, which id also called Os08g05520, encodes an R2R3-MYB transcription factor. OsMYB103L may target CESA genes for regulation of cellulose synthesis thus influences leaf shape and mechanical strength in rice, which makes it a potential engineering target for desirable leaf mechanical properties. OsMYB103L is localized in the nucleus and has transactivation activity. Overexpression of OsMYB103L in rice could result in a rolled leaf phenotype, and significantly higher levels of several cellulose synthase genes (CESAs), and a significant cellulose content increase. Knockdown of OsMYB103L by RNA interference could lead to a decreased level of cellulose content thus reduced mechanical strength in leaves. Meanwhile, the
+OsMYB103L[7], which id also called Os08g05520, encodes an R2R3-MYB transcription factor. OsMYB103L may target CESA genes for regulation of cellulose synthesis thus influences leaf shape and mechanical strength in rice, which makes it a potential engineering target for desirable leaf mechanical properties. OsMYB103L is localized in the nucleus and has transactivation activity. Overexpression of OsMYB103L in rice could result in a rolled leaf phenotype, and significantly higher levels of several cellulose synthase genes (CESAs), and a significant cellulose content increase. Knockdown of OsMYB103L by RNA interference could lead to a decreased level of cellulose content thus reduced mechanical strength in leaves. Meanwhile, the
 expression levels of the relevant CESA genes could also be decreased.
@@ Line 64: / Line 64: @@
 In summary, the down-regulated CESA genes in OsMYB103L RNAi plants led to decrease in cellulose content and weakened mechanical strength of transgenic leaf blades.
@@ Line 78: / Line 90: @@
 Richmond T: Higher plant cellulose synthases. Genome Biol 2000, 1(4):REVIEWS3001.

← Older revision		Revision as of 07:21, 11 June 2014
Line 51:		Line 51:
	CESAs are proteins responsible for cellulose synthesis in plants[4-6]. And the measuring results of cellulose content in leaf blades of WT and OE plants showed indeed that OE leaf blades had 13% higher cellulose content compared to WT. In summary, OsMYB103L regulates CESA gene expression and may consequently influence cellulose synthesis in rice.		CESAs are proteins responsible for cellulose synthesis in plants[4-6]. And the measuring results of cellulose content in leaf blades of WT and OE plants showed indeed that OE leaf blades had 13% higher cellulose content compared to WT. In summary, OsMYB103L regulates CESA gene expression and may consequently influence cellulose synthesis in rice.

		+	RNAi-knockdown plants for OsMYB103L were created and the leaves appeared brittle in the heading stage although there were no obvious morphological alterations compared to wild type (see this Figure B below).

		+	[[File:20140611150055.png]]
		+
		+	Results of cellulose content measurement showed that compared with WT, the levels of cellulose content in RNAi lines significantly decreased (see this Figure D below).
		+
		+	[[File:20140611150334.png]]
		+
		+	Therefore, the decreased mechanical strength of RNAi plants might result from the decreased cellulose content. qRT-PCR results also showed that three CESA genes, OsCESA4, OsCESA7, and OsCESA9 were significantly down-regulated in the RNAi lines (see this Figure E below).
		+
		+	[[File:20140611150657.png]]
		+
		+	In summary, the down-regulated CESA genes in OsMYB103L RNAi plants led to decrease in cellulose content and weakened mechanical strength of transgenic leaf blades.

@@ Line 56: / Line 56: @@
 ==References==
 Zhong R, Lee C, Zhou J, McCarthy RL, Ye ZH: A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis. Plant Cell 2008, 20(10):2763–2782.
 Du Z, Zhou X, Ling Y, Zhang Z, Su Z: agriGO: a GO analysis toolkit for the agricultural community. Nucleic Acids Res 2010, 38(Web Server issue):W64–W70.
 Fang L, Zhao F, Cong Y, Sang X, Du Q, Wang D, Li Y, Ling Y, Yang Z, He G: Rollingleaf14 is a 2OG-Fe (II) oxygenase family protein that modulates rice leaf rolling by affecting secondary cell wall formation in leaves. Plant Biotechnol J 2012, 10(5):524–532.
 Wang L, Guo K, Li Y, Tu Y, Hu H, Wang B, Cui X, Peng L: Expression profiling and integrative analysis of the CESA/CSL superfamily in rice. BMC Plant Biol 2010, 10:282.
 Somerville C: Cellulose synthesis in higher plants. Annu Rev Cell Dev Biol 2006, 22:53–78.
 Richmond T: Higher plant cellulose synthases. Genome Biol 2000, 1(4):REVIEWS3001.

@@ Line 14: / Line 14: @@
 According to the rice genome annotation database ([http://rice.plantbiology.msu.edu]), LOC_Os08g05520 encodes a putative R2R3-
 MYB family transcription factor with a length of 359 amino acids and a molecular mass of approximately 40 kD. The Pfam database ([http://pfam.sanger.ac.uk/]) shows that the deduced protein has two MYB DNA-binding domains (PF00249) at the N-terminus. As revealed by phylogenetic analysis of the related MYB transcription factors in Arabidopsis
-thaliana and rice, Os08g05520 is closely related to At1g63910 (AtMYB103). Protein sequence alignment showed that they are highly conserved in the predicted R2- and R3-MYB DNA-binding domains. That's why Os08g05520 was designated as OsMYB103L (Oryza sativa MYB103 Like).
+thaliana and rice, Os08g05520 is closely related to At1g63910 (AtMYB103)[1]. Protein sequence alignment showed that they are highly conserved in the predicted R2- and R3-MYB DNA-binding domains. That's why Os08g05520 was designated as OsMYB103L (Oryza sativa MYB103 Like).
@@ Line 37: / Line 37: @@
 [[File:20140611140519.png]].

@@ Line 23: / Line 23: @@
 After determining the expression level of OsMYB103L in various rice organs using quantitative real-time PCR (qRT-PCR), it was found out that The expression level of OsMYB103L was highest in culm, lower in root, leaf and mature panicle, and lowest in
-young panicle.(see this fugure)[[File:20140611134107.png]]
+young panicle.(see this fugure)
 Also the examination of the expression pattern of OsMYB103L by the β-glucuronidase(GUS) reporter gene driven by OsMYB103L putative promoter in three independent transgenic lines showed that the GUS signals were stronger in culm and weaker in vascular bundles of coleoptile, root and leaf. Meanwhile, GUS staining was stronger in mature panicle than young panicle. Further examination showed that GUS activity was detectable in pedicel, lemma and palea while no GUS activity was detected in sterile lemma, lodicule, pistil, and stamen in mature panicle. These results indicate OsMYB103L's diverse expressions in various tissues and organs in rice.
-The most significant phenotype of OsMYB103L overexpression(OE) lines was upward curling of the leaf blades. This phenotype appeared first at the seedling stage and then maintained through the rest of the plant growth (Figure B, see this fugure)[[File:20140611140441.png]].
+The most significant phenotype of OsMYB103L overexpression(OE) lines was upward curling of the leaf blades. This phenotype appeared first at the seedling stage and then maintained through the rest of the plant growth (Figure B, see this fugure)
-The leaf blade cross-sections did not show significant differences between wild type (WT) and OE in terms of organization of the sclerenchyma and vascular tissues. It suggests that there is no obvious alteration of leaf polarity in transgenic plants. However, in contrast to WT, the leaves of transgenic plants displayed smaller bulliform cells in the rolled regions (Figure D, see this figure)[[File:20140611140519.png]].
+[[File:20140611140519.png]].

← Older revision		Revision as of 06:19, 11 June 2014
Line 28:		Line 28:

	The most significant phenotype of OsMYB103L overexpression(OE) lines was upward curling of the leaf blades. This phenotype appeared first at the seedling stage and then maintained through the rest of the plant growth (Figure B, see this fugure)[[File:20140611140441.png]].		The most significant phenotype of OsMYB103L overexpression(OE) lines was upward curling of the leaf blades. This phenotype appeared first at the seedling stage and then maintained through the rest of the plant growth (Figure B, see this fugure)[[File:20140611140441.png]].
−	The leaf blade cross-sections did not show significant differences between wild type (WT) and OE in terms of organization of the sclerenchyma and vascular tissues. It suggests that there is no obvious alteration of leaf polarity in transgenic plants. However, in contrast to WT, the leaves of transgenic plants displayed smaller bulliform cells in the rolled regions (Figure D, see this figure)[[File:20140611140519.png]].	+
		+	The leaf blade cross-sections did not show significant differences between wild type (WT) and OE in terms of organization of the sclerenchyma and vascular tissues. It suggests that there is no obvious alteration of leaf polarity in transgenic plants. However, in contrast to WT, the leaves of transgenic plants displayed smaller bulliform cells in the rolled regions (Figure D, see this figure)[[File:20140611140519.png]].

@@ Line 24: / Line 24: @@
 After determining the expression level of OsMYB103L in various rice organs using quantitative real-time PCR (qRT-PCR), it was found out that The expression level of OsMYB103L was highest in culm, lower in root, leaf and mature panicle, and lowest in
 young panicle.(see the figure below)
-[[File:20140611134107.jpg]]
+[[File:20140611134107.png]]

← Older revision		Revision as of 05:55, 11 June 2014
Line 23:		Line 23:

	After determining the expression level of OsMYB103L in various rice organs using quantitative real-time PCR (qRT-PCR), it was found out that The expression level of OsMYB103L was highest in culm, lower in root, leaf and mature panicle, and lowest in		After determining the expression level of OsMYB103L in various rice organs using quantitative real-time PCR (qRT-PCR), it was found out that The expression level of OsMYB103L was highest in culm, lower in root, leaf and mature panicle, and lowest in
−	young panicle.	+	young panicle.(see the figure below)
		+	[[File:20140611134107.jpg]]