Duweili13 at 01:21, 29 May 2014

2014-05-29T01:21:36Z

Duweili13: Created page with "==Annotated Information== ===Function=== Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) ..."

2014-05-29T00:53:29Z

Created page with "==Annotated Information== ===Function=== Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) ..."

New page

==Annotated Information==
===Function===
Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) and intracellular non-RD (arginine - aspartate) kinase domains. XA21-mediated immunity is activated upon recognition of a 194-amino acid protein designated Ax21 (activator of XA21-mediated innate immunity). Non-RD kinases usually carry a cysteine or glycine in place of the arginine and can induces inflammatory responses by both NLRs and TLRs. XA21 biogenesis occurs in the endoplasmic reticulum (ER) and the phosphorylation state of XA21 is critical for XA21-mediated signaling.

===Localization===
XA21 is a kind of transmembrane protein.

===Evolution===
Genome analyses have revealed an approximately 10-fold greater number of non-RD receptor kinases in rice (328) than inArabidopsis (35). These results suggest that rice has a vastly expanded capacity to recognize conserved microbial signature molecules.

==Labs working on this gene==
*Department of Ecology and Evolution, University of Chicago, 1101 E. 57th Street, Chicago, IL 60637, USA
*Department of Plant Pathology, University of California, Davis, CA 95616, USA
*Division of Plant Sciences, National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602,Japan
*Biotechnology Research Center, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan

==References==
* Song, W.Y.et al.(1995) A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21.Science270, 1804–1806
* Dardick, C. and Ronald, P. (2006) Plant and animal pathogen recognition receptors signal through non-RD kinases.PLoS Pathog. 2, e2
* Towb, P.et al.(2009) Tube Is an IRAK-4 homolog in a Toll pathway adapted for development and immunity.J. Innate Immun.1, 309–321
* Park, C.J. et al. (2010) Elucidation of XA21-mediated innate immunity. Cell. Microbiol.12, 1017–1025

==Structured information==
{{JaponicaGene|
GeneName = xa21|
Description =receptor kinase-like protein |
Version = AY885788.1 GI: 63098480|
Length = 1091 bp|
Definition = Oryza sativa (indica cultivar-group) isolate Xa21 receptor kinase-like protein(Xa21) gene, partial cds.|
Chromosome = Chromosome 11|
CDNA=
<cdnaseq>TTGATAAGATCACAGGAAGCATTCCAAAGGATATTGGCAATCTTATTGGCTTACAACATCTCTATCTCTGCAACAACAATTTCAGAGGGTCTCTTCCATCATCGTTGGGCAGGCTTAGAAACTTAGGCATTCTAGTCGCCTACGAAAACAACTTGAGCGGTTCGATCCCATTGGCCATAGGAAATCTTACTGAACTTAATATCTTACTGCTCGGCACCAACAAATTCAGTGGTTGGATACCATACACACTCTCAAACCTCACAAACTTGTTGTCATTAGGCCTTTCAACTAATAACCTTAGTGGTCCAATACCCAGTGAATTATTCAATATTCAAACACTATCAATAATGATCAATGTATCAAAAAATAACTTGGAGGGATCAATACCACAAGAAATAGGGCATCTCAAAAATCTAGTAGAATTTCATGCAGAATCGAATAGATTATCAGGTAAAATCCCTAACACGCTTGGTGATTGCCAGCTCTTACGGTATCTTTATCTGCAAAATAATTTGTTATCTGGTAGCATCCCATCAGCCTTGGGTCAGCTGAAAGGTCTCGAAACTCTTGATCTCTCAAGCAACAATTTGTCAGGCCAGATACCCACATCCTTAGCAGATATTACTATGCTTCATTCCTTGAACCTTTCTTTCAACAGCTTTATGGGGGAAGTGCCAACCATTGGTGCTTTCGCAGATGCATCCGGGATCTCAATCCAAGGCAATGCCAAACTCTGTGGTGGAATACCTGATCTACATCTGCCTCGATGTTGTCCATTACTAGAGAATAGAAAACATTTCCCAGTTCTACCTATTTCTGTTTCTCTGGTCGCAGCACTGGCCATCCTCTCATCACTCTACTTGCTTATAACCTGGCACAAGAGAACTAAAAAGGGAGCCCCTTCAAGAACTTCCATGAAAGGCCACCCATTGGTCTCTTATTCGCAGTTGGTAAAAGCAACAGATGGTTTCGCGCCGACTAATTTGTTGGGTTCTGGATCATTTGGCTCAGTATACAAAGGAAAGCTTAATATCCAAGATCATTTGCAGTGAAGGTACTAAAGCTTGAAAATCCTAAGGCACTCAAGAGT</cdnaseq>|
AA=
<aaseq>DKITGSIPKDIGNLIGLQHLYLCNNNFRGSLPSSLGRLRNLGILVAYENNLSGSIPLAIGNLTELNILLL
GTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVE
FHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITML
HSLNLSFNSFMGEVPTIGAFADASGISIQGNAKLCGGIPDLHLPRCCPLLENRKHFPVLPISVSLVAALA
ILSSLYLLITWHKRTKKGAPSRTSMKGHPLVSYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKS</aaseq>|
Source = Oryza sativa Indica Group (long-grained rice)
}}

@@ Line 1: / Line 1: @@
 ==Annotated Information==
 ===Function===
- Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) and intracellular non-RD (arginine - aspartate) kinase domains. XA21-mediated immunity is activated upon recognition of a 194-amino acid protein designated Ax21 (activator of XA21-mediated innate immunity). Non-RD kinases usually carry a cysteine or glycine in place of the arginine and can induces inflammatory responses by both NLRs and TLRs. XA21 biogenesis occurs in the endoplasmic reticulum (ER) and the phosphorylation state of XA21 is critical for XA21-mediated signaling.
+  Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM)
 ===Localization===
@@ Line 7: / Line 11: @@
 ===Evolution===
-  Genome analyses have revealed an approximately 10-fold greater number of non-RD receptor kinases in rice (328) than inArabidopsis (35). These results suggest that rice has a vastly expanded capacity to recognize conserved microbial signature molecules.
+  Genome analyses have revealed an approximately 10-fold greater number of non-RD receptor kinases

User talk:Duweili13 - Revision history

Duweili13 at 01:21, 29 May 2014

Duweili13: Created page with "==Annotated Information== ===Function=== Xa21 encodes a receptor kinase carrying extracellular leucine-rich repeats (LRRs), as well as transmembrane (TM), juxtamembrane (JM) ..."