Difference between revisions of "BGIOSGA027011"
| Line 1: | Line 1: | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
Revision as of 17:06, 22 July 2012
Please input one-sentence summary here.
Contents
- 1 Annotated Information
- 2 Labs working on this gene
- 3 References
- 4 Structured Information
- 5 Annotated Information
- 6 Labs working on this gene
- 7 References
- 8 Structured Information
- 9 Annotated Information
- 10 Labs working on this gene
- 11 References
- 12 Structured Information
- 13 Annotated Information
- 14 Labs working on this gene
- 15 References
- 16 Structured Information
- 17 Annotated Information
- 18 Labs working on this gene
- 19 References
- 20 Structured Information
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Please input one-sentence summary here.
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
BGIOSGA027011 |
|---|---|
| Description |
Putative uncharacterized protein |
| Definition |
Oryza sativa Indica Group BGIOSGA027011, complete gene. |
| LocusTag |
OsI_29165 |
| Ensembl Transcript ID |
BGIOSGA027011-TA |
| Ensembl Protein ID |
BGIOSGA027011-PA |
| Length |
504 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:20404996..20405499 |
| Sequence Coding Region |
20404996..20405499 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome08:20404996..20405499 source=RiceIndica08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome08:20404996..20405499 source=RiceIndica08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGCCCTCAGCCTCAGTACCTGAAATCCCCATCCAACTTCAACTGCGGCGGCGGCTTCGGCTGGTTGCGGCGTTGGGAAGCGACGGCGGTGGTGATGGCTCGGCCGGTCATGGCGCACCAGGGAGCTCGCCGCGCTGCAGGACCAGCAACACCATGAGTTCCGCGCTGCAAGAGCTCGCCGCGCATGCTGCGAACTCCGGCGAAGGCGCCACGCTGCCGCCGTGGTGCGTCTCGAAGCTGAGCCCCACAGCGCCATCGCCGCCGCCGCAGGCCACGGTCTGCAGGTCCTGTTCTCCACAGACCCATCACCATGGATCCAGCTCAAACCTGCACACACATCAACAAGAAACCAATCAACGGCAACAAATCGATCAAATGCAATGCACAAATCACAATGGCGATGGAGCCGCTCGCCACCACCACCCGCTGCTGCAGCCACTCTGCAACGCCGCCACCGCAGCCACGGCGCAGAGCTCGGCCAAGTCCGCGCCACCGACGCTGTAG</cdnaseq> |
| Protein Sequence |
<aaseq>MPSASVPEIPIQLQLRRRLRLVAALGSDGGGDGSAGHGAPGSSPRCRTSNTMSSALQELAAHAANSGEGATLPPWCVSKLSPTAPSPPPQATVCRSCSPQTHHHGSSSNLHTHQQETNQRQQIDQMQCTNHNGDGAARHHHPLLQPLCNAATAATAQSSAKSAPPTL</aaseq> |
| Gene Sequence |
<dnaseqindica>1..504#ATGCCCTCAGCCTCAGTACCTGAAATCCCCATCCAACTTCAACTGCGGCGGCGGCTTCGGCTGGTTGCGGCGTTGGGAAGCGACGGCGGTGGTGATGGCTCGGCCGGTCATGGCGCACCAGGGAGCTCGCCGCGCTGCAGGACCAGCAACACCATGAGTTCCGCGCTGCAAGAGCTCGCCGCGCATGCTGCGAACTCCGGCGAAGGCGCCACGCTGCCGCCGTGGTGCGTCTCGAAGCTGAGCCCCACAGCGCCATCGCCGCCGCCGCAGGCCACGGTCTGCAGGTCCTGTTCTCCACAGACCCATCACCATGGATCCAGCTCAAACCTGCACACACATCAACAAGAAACCAATCAACGGCAACAAATCGATCAAATGCAATGCACAAATCACAATGGCGATGGAGCCGCTCGCCACCACCACCCGCTGCTGCAGCCACTCTGCAACGCCGCCACCGCAGCCACGGCGCAGAGCTCGGCCAAGTCCGCGCCACCGACGCTGTAG</dnaseqindica> |
| External Link(s) |