Difference between revisions of "BGIOSGA034684"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  

Revision as of 18:07, 22 July 2012

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

BGIOSGA034684

Description

Putative uncharacterized protein

Definition

Oryza sativa Indica Group BGIOSGA034684, complete gene.

LocusTag

OS11G0115400

Ensembl Transcript ID

BGIOSGA034684-TA

Ensembl Protein ID

BGIOSGA034684-PA

Length

465

Source

Oryza sativa Indica Group

 ORGANISM  Oryza sativa Indica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:390666..391130

Sequence Coding Region

390666..391006,391121..391130

Genome Context

<gbrowseImage1> name=IndicaChromosome11:390666..391130 source=RiceIndica11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=IndicaChromosome11:390666..391130 source=RiceIndica11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ATGGCCCGTGCACAGTTGGTGTTGGTCGCCGTTGTGGCAGCTCTGCTCCTCGCCGCCCCGCACGCCGCCGTGGCCATCACCTGCGGCCAGGTCAACTCCGCCGTTGGGCCCTGCCTCACCTACGCCCGCGGCGGCGCCGGCCCGTCGGCGGCCTGCTGCAGCGGCGTGAGGAGCCTCAAGGCCGCAGCCAGCAGCACCGCTGACAGGCGCACCGCGTGCAACTGCCTCAAGAACGCGGCCCGCGGCATCAAGGGGCTCAACGCCGGCAACGCCGCCAGCATCCCCTCTAAGTGCGGCGTCAGCGTCCCCTACACCATCAGCGCTTCCATCGACTGCTCCAGGGTGAGCTGA</cdnaseq>

Protein Sequence

<aaseq>MARAQLVLVAVVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS</aaseq>

Gene Sequence

<dnaseqindica>1..341#456..465#ATGGCCCGTGCACAGTTGGTGTTGGTCGCCGTTGTGGCAGCTCTGCTCCTCGCCGCCCCGCACGCCGCCGTGGCCATCACCTGCGGCCAGGTCAACTCCGCCGTTGGGCCCTGCCTCACCTACGCCCGCGGCGGCGCCGGCCCGTCGGCGGCCTGCTGCAGCGGCGTGAGGAGCCTCAAGGCCGCAGCCAGCAGCACCGCTGACAGGCGCACCGCGTGCAACTGCCTCAAGAACGCGGCCCGCGGCATCAAGGGGCTCAACGCCGGCAACGCCGCCAGCATCCCCTCTAAGTGCGGCGTCAGCGTCCCCTACACCATCAGCGCTTCCATCGACTGCTCCAGGTATTCATCTCATCATCTCTAATTATATATATTCTGTTAAATATAATTAATTAAGCATGGCTAATTGCATGATATATACTCCATCATCTAATATATATATGTGCATGTGTGCAGGGTGAGCTGA</dnaseqindica>

External Link(s)

EnsemblPlants:BGIOSGA034684