Difference between revisions of "BGIOSGA011011"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  

Revision as of 21:49, 22 July 2012

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

BGIOSGA011011

Description

Putative uncharacterized protein

Definition

Oryza sativa Indica Group BGIOSGA011011, complete gene.

LocusTag

OsI_10949

Ensembl Transcript ID

BGIOSGA011011-TA

Ensembl Protein ID

BGIOSGA011011-PA

Length

291

Source

Oryza sativa Indica Group

 ORGANISM  Oryza sativa Indica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:9972196..9972486

Sequence Coding Region

9972196..9972486

Genome Context

<gbrowseImage1> name=IndicaChromosome03:9972196..9972486 source=RiceIndica03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=IndicaChromosome03:9972196..9972486 source=RiceIndica03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ATGAAGTTCAATTGCAAGAATCAGTTCAAGAAGGCCATCACAAAATATGCATTAGCTGAGAAGAAGGTGATCAATTTTATAAAAGATGATCAGAAAAGGGTCAGGGGCAAGTGTGACTGGGATACCTGTCAATGGGTCTGTTTGCTATCAAAGAACTCCAGGTCTGACAGTTGGCAAATTGTGACATATGAGAGCTTGCATGCTTGCCCACCAAGGAGGGATAACAAGATGGTGACAGCCACAAGGATTGCTCAGAAGTATTGGAAGTTCATAGCTGCCAACCCATCCTAG</cdnaseq>

Protein Sequence

<aaseq>MKFNCKNQFKKAITKYALAEKKVINFIKDDQKRVRGKCDWDTCQWVCLLSKNSRSDSWQIVTYESLHACPPRRDNKMVTATRIAQKYWKFIAANPS</aaseq>

Gene Sequence

<dnaseqindica>1..291#ATGAAGTTCAATTGCAAGAATCAGTTCAAGAAGGCCATCACAAAATATGCATTAGCTGAGAAGAAGGTGATCAATTTTATAAAAGATGATCAGAAAAGGGTCAGGGGCAAGTGTGACTGGGATACCTGTCAATGGGTCTGTTTGCTATCAAAGAACTCCAGGTCTGACAGTTGGCAAATTGTGACATATGAGAGCTTGCATGCTTGCCCACCAAGGAGGGATAACAAGATGGTGACAGCCACAAGGATTGCTCAGAAGTATTGGAAGTTCATAGCTGCCAACCCATCCTAG</dnaseqindica>

External Link(s)

EnsemblPlants:BGIOSGA011011