Difference between revisions of "BGIOSGA014263"

From RiceWiki
Jump to: navigation, search
 
Line 1: Line 1:
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
Please input one-sentence summary here.
 
 
==Annotated Information==
 
===Function===
 
Please input function information here.
 
 
===Expression===
 
Please input expression information here.
 
 
===Evolution===
 
Please input evolution information here.
 
 
You can also add sub-section(s) at will.
 
 
==Labs working on this gene==
 
Please input related labs here.
 
 
==References==
 
Please input cited references here.
 
 
==Structured Information==
 
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  

Latest revision as of 21:50, 22 July 2012

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

BGIOSGA014263

Description

Putative uncharacterized protein

Definition

Oryza sativa Indica Group BGIOSGA014263, complete gene.

LocusTag

OsI_17596

Ensembl Transcript ID

BGIOSGA014263-TA

Ensembl Protein ID

BGIOSGA014263-PA

Length

2518

Source

Oryza sativa Indica Group

 ORGANISM  Oryza sativa Indica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:31366567..31369084

Sequence Coding Region

31368854..31369084,31368651..31368761,31368381..31368443,31368172..31368285,31366567..31367115

Genome Context

<gbrowseImage1> name=IndicaChromosome04:31366567..31369084 source=RiceIndica04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=IndicaChromosome04:31366567..31369084 source=RiceIndica04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ATGACGGGCGCCGCCGCCGCCGCCGCCGCCGTCTCCCCGCTCGTCGCGTGGCCCCGCTCCGCGCCCGCCTCGCGGGGCGGCAGGCGTGCGGCGCGCGCGTCGGCGTTCCACCCGGACGTGTCCCGCGCGGTGGAGTCGCTGCAGGCGGAGTTCCGGGAGGTGGACCGCGCGCTCGCCCTCAACTCCGCCCGCGTCTCCGCCGCCTTCCACGCCGCCCACGTCGCGCCGCACCATTTCGGTGGCTCGACGGGGTACGGCCACGACGACGGGGGCGGCAGGGAGGTGCTCGACTCCGTCTTCGCCCAGATCGTCGGCGCCGAGGCCGCCATTGTCCGCCCCCAGTTCTTCTCCGGGACGCACGCCATTGCCTGTGCTCTGTTTGCTCTTCTGAGGCCTGGACACGAGCTCCTGGCTGTCGCTGGTCCTCCCTATGACACCTTGGAGGAGGTGATTGGGATCAGGGGGTCGGCCAATGTGGGATCGCTCAAGGATTTTGGAGTGGCATACCGAGAAGTTCCGGCGTGCAACCTGATGTGCCTGCCGGAGAACTACCAGATGAAGTACTACCTCTACCACATGCTGTCGTGGCCGCAGCTGCTGTTCGTGGCGGAGGATTACGGCGGCCGGATCGTCGGCTACGTGCTCGCGAAGATGGAGGAGGACCCCTCGGAGCCTTGCCACGGCCACATCACCTCCCTCGCCGTGCTCCGCTCCCACCGCAAGCTCGGCCTCGCCACCAAGCTCATGTCCGCCGCGCAGGCTGCCATGGACCAGGTGTTCGGCGCCGAGTACGTCTCCCTCCACGTCCGCCGCTCCAACCGCGCGGCCTTCAACCTCTACACCTCCACGCTCGGGTACCAGATCCACGACGTCGAGGCCAAGTACTACGCCGACGGCGAGGACGCCTACGACATGCGCAAGCCGCTGCGGCAGCCGCAGCCCAAGAAGCACCACCATCACCACCACCATCATCACGGCCCCGGTGGTTGTTGCTCACACGATGCTCCTCCCGCGGCATCTGGGTCTTCTCCGCCGTCCTCTAATTCGCCAGAGAAGACCGATTCATGA</cdnaseq>

Protein Sequence

<aaseq>MTGAAAAAAAVSPLVAWPRSAPASRGGRRAARASAFHPDVSRAVESLQAEFREVDRALALNSARVSAAFHAAHVAPHHFGGSTGYGHDDGGGREVLDSVFAQIVGAEAAIVRPQFFSGTHAIACALFALLRPGHELLAVAGPPYDTLEEVIGIRGSANVGSLKDFGVAYREVPACNLMCLPENYQMKYYLYHMLSWPQLLFVAEDYGGRIVGYVLAKMEEDPSEPCHGHITSLAVLRSHRKLGLATKLMSAAQAAMDQVFGAEYVSLHVRRSNRAAFNLYTSTLGYQIHDVEAKYYADGEDAYDMRKPLRQPQPKKHHHHHHHHHGPGGCCSHDAPPAASGSSPPSSNSPEKTDS</aaseq>

Gene Sequence

<dnaseqindica>1..231#324..434#642..704#800..913#1970..2518#ATGACGGGCGCCGCCGCCGCCGCCGCCGCCGTCTCCCCGCTCGTCGCGTGGCCCCGCTCCGCGCCCGCCTCGCGGGGCGGCAGGCGTGCGGCGCGCGCGTCGGCGTTCCACCCGGACGTGTCCCGCGCGGTGGAGTCGCTGCAGGCGGAGTTCCGGGAGGTGGACCGCGCGCTCGCCCTCAACTCCGCCCGCGTCTCCGCCGCCTTCCACGCCGCCCACGTCGCGCCGCACGTAAACCTCCCTCGTCTTCTCTCCTCCTCCGCCGTATGCGGCTCGCTGTCAGGTTCAGGGTATGACGCGCACGCGGCATCCGCGAATTTCAGCATTTCGGTGGCTCGACGGGGTACGGCCACGACGACGGGGGCGGCAGGGAGGTGCTCGACTCCGTCTTCGCCCAGATCGTCGGCGCCGAGGCCGCCATTGTCCGCCCCCAGGTTCCATGTCCACACGCGCTACCATTTCTCTCTGACTCCCCCCATTTCTCCATACATTCCACTCCACTCTCTCCACTGCTTCCATTGCTGAGCTCCACTGAGCTTCTTGTACCTACTCCGTAATATATTGACGTGCAATCCTTTTACGCGTTCGTGAAAAACTGAGCTTCTTATACTAGTGATGAGCTCTTTGTTAATCGGTTCCAGTTCTTCTCCGGGACGCACGCCATTGCCTGTGCTCTGTTTGCTCTTCTGAGGCCTGGACACGAGGTAAGAGATTAGAGAACACCTGGATGAACTGAGTTTTCGCATTGCTTCTGCTAGCTTAGAAACTGGGAGCTGATGAAAATTTAGAAAATGTGTAGCTCCTGGCTGTCGCTGGTCCTCCCTATGACACCTTGGAGGAGGTGATTGGGATCAGGGGGTCGGCCAATGTGGGATCGCTCAAGGATTTTGGAGTGGCATACCGAGAAGTTCCGGTTTGTTGATTTCTTCACCTTACAAACACCAGGAATGCTTTACATTGTGCTATTTGTGAGTTACTGATGTGGCTTCAGTTGTAGCTTGCAGCAGATGGTGGCCTTGATTGGGATGCTCTTGCAAATGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCTCCTGCTGCTGCTGGCACTCGGCGCTGCGGCGCTGAGCGTGGGCATCCTGCACAAGATGAGGGAGCGCCGCGTCTTCTCCATCCTCCTCCAGGAACGCGATCAGCAGCTTATCTCCCTTCAAGCCCTCCTGCAGGTATGGATATATTTCTGGAATATCATGCATCGAATTCTTATACATTGGCCATCCAGGAAGTTGTAGCCAAAAAATAGTCTAGCATTATATATTTTTTAATCAACACATCATGTTCACATAATACAAGTACTGAAATAAATTCAAGCCCCCCTAAGAGGCTAGAAGCTGTACTCCCGAAGAATGTGAATGTGTACTCGGTATCCCTGTGCTAATTAATATTCCCTCCGTATTTTAATGTATGACGCCGTTGACTTTTCGACCAACGTTTGACCATTCGTTTTATTCAAAATTTTTGTGCAAATATGAAAATATTTATGTCATGCTTAAGAACATTTGATGACAAATCAAGTCATAATAAAATAAATGATAATTATATAAATTTTTTGAATAAGACGAATGGTCAAACGTTGGACAAAAAATCAACGGCGTCATACATTAAAATATGGAGGTAGTAGATGAAGTATACACCTCACCCTGCACTACTGCACTCACAAAAGTCATGTAAAGCCCAAGCTGTGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCCCTCCTCACCTCTATTAATCCGCAGGAGAGGCCGCCGCCACCACCACCGTCCGCATCGCGATCACCCACCACCACATCACGCCGGAGAAGTAGTCGGCGGCGGCGGCGGCGAAGGCGAAGATGGTGTGCATACGGCAGGCGACGATCGACGACCTGCTGGCGATGCAGGCGTGCAACCTGATGTGCCTGCCGGAGAACTACCAGATGAAGTACTACCTCTACCACATGCTGTCGTGGCCGCAGCTGCTGTTCGTGGCGGAGGATTACGGCGGCCGGATCGTCGGCTACGTGCTCGCGAAGATGGAGGAGGACCCCTCGGAGCCTTGCCACGGCCACATCACCTCCCTCGCCGTGCTCCGCTCCCACCGCAAGCTCGGCCTCGCCACCAAGCTCATGTCCGCCGCGCAGGCTGCCATGGACCAGGTGTTCGGCGCCGAGTACGTCTCCCTCCACGTCCGCCGCTCCAACCGCGCGGCCTTCAACCTCTACACCTCCACGCTCGGGTACCAGATCCACGACGTCGAGGCCAAGTACTACGCCGACGGCGAGGACGCCTACGACATGCGCAAGCCGCTGCGGCAGCCGCAGCCCAAGAAGCACCACCATCACCACCACCATCATCACGGCCCCGGTGGTTGTTGCTCACACGATGCTCCTCCCGCGGCATCTGGGTCTTCTCCGCCGTCCTCTAATTCGCCAGAGAAGACCGATTCATGA</dnaseqindica>

External Link(s)

EnsemblPlants:BGIOSGA014263